Dbfetch

ID   AK032525; SV 1; linear; mRNA; HTC; MUS; 2979 BP.
XX
AC   AK032525;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 13)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430580C01 product:G PROTEIN-COUPLED RECEPTOR 37, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2979
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9ae3daf614608d6fa96ebfe891dacfec.
DR   Ensembl-Gn; ENSMUSG00000039904; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030503; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030476; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030403; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030486; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030940; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0029601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030177; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030321; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030408; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030311; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030970; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029315; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0029677; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054867; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200812; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0076528; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0076608; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0076512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0076547; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0076170; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0077020; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0076735; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0076135; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0076282; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0076177; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0076333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0076190; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0077255; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0076172; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0075299; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430580C01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2979
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430580C01"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS             721..2523
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="G PROTEIN-COUPLED RECEPTOR 37 (SPTR|Q9QY42,
FT                   evidence: FASTY, 99.3%ID, 100%length, match=1800)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9QY42"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1313297"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QY42"
FT                   /protein_id="BAC27911.1"
FT                   /translation="MPARGAPLSRTSRLLLLLLFKVSVSAALSFVPEPRNGTCLGESCS
FT                   PLIQRRSRDARGPGNSAKDALRVHVPREKLEAEVRGATSWDLPPPRGGDTGVIEEAAAA
FT                   GPLGPPTKPPSAWRWKSAQGKEPSGHLRRRDPTDPQLFFPTSEGGEMSSKRDGIPQSRQ
FT                   EHSVKTEPRDLFYWPRRTGQLQDSQHRPSAVHEGRTLAPPGMALPQNGSADDWVPDQGG
FT                   PRRGNTTRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRS
FT                   ISNSLLANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPNIEVASLGVTTFTLC
FT                   ALCIDRFRAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSG
FT                   QAPAERCVIKISPDLPDTIYVLALTYDGARLWWYFGCYFCLPTLFTITCSLVTARKIRK
FT                   AEKASTRGNKRQIHLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLL
FT                   NIISQFLLFFKSCVTPVLLFCLCRPFSRAFMECYCCCCEECIQKSSTVTSDDNDNEYTT
FT                   ELELSPFSTIRREMSTFASVGNHC"
FT   regulatory      2958..2963
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2979
FT                   /note="putative"
XX
SQ   Sequence 2979 BP; 676 A; 768 C; 750 G; 785 T; 0 other;
     gaggcgcagc cgctggcgcc atccacttgt caactttgaa ctgaaggagc agcaactttg        60
     acagtggccg cgggtttcga atctggcttc tccttggcaa cagtcccttt gaaagtcgtc       120
     ggagttaaac gaagcaagag tttcctctgt gctccggtgg tgccttgttt gcaagggtcc       180
     ccacccccca cccccccgcc agccgagagt gggattgtga cagccagtcc cctagtggag       240
     cggacttgtt tttctttttc tctagagacc tctaatagcg actggataaa gcagtatgga       300
     aaggatgtaa atagcagagc aactgttacc aagaagacag ccaccaccca aaggctggga       360
     ggagcgcggg gcttcctcca ggctgcgccc agtcgcaaca ttagggaaca atcaggtggt       420
     gttcgcaact tttcaaggtc agcctcttgg atctgttatt tccctgggaa ccttcgggtg       480
     caccgagctt ggattagatt tggctgggaa atgctcagaa catgaaacgt ggaaggattg       540
     tagggatgtg ttgatgacac cgtccttccc caagcgccct gttccctccc agcaatcttc       600
     tgctcccatc ctctacccag cggtgagtat gtgacatgtg cctaactctc tgcaccaagt       660
     ttggcagcag gtgtcggtgc taagctagag ccaggctagt aggtgcgccc tcgccgagcc       720
     atgccagccc ggggcgcgcc tctctcgcgc acatcgcggc tgctgctcct tctgctgttt       780
     aaggtttctg tctctgctgc cctgagcttt gtccctgagc ccaggaatgg aacttgtctg       840
     ggggagagct gttccccact gatccaacgc cgcagcaggg atgcccgtgg acctgggaat       900
     tcggcaaaag acgctctgcg agtccatgtg cccagagaga aactggaagc agaggtgaga       960
     ggggcgacct cttgggacct cccaccaccc aggggcggtg acacaggtgt gattgaagaa      1020
     gcggcggctg ctgggccctt gggacctcca accaagccac caagtgcctg gagatggaaa      1080
     agtgcccagg gtaaagaacc atccgggcat ttgaggagaa gggaccccac ggatccccaa      1140
     ctcttctttc cgacatcgga ggggggagag atgagttcca agcgcgatgg gattccccag      1200
     agcaggcagg agcacagtgt gaaaacggaa cccagagatc ttttttactg gccacgaaga      1260
     actggacaac tccaggattc ccaacacagg ccttcagcag tacacgaagg aaggaccctt      1320
     gctcctccag gcatggcact accgcaaaac gggtctgcag atgactgggt tcctgaccaa      1380
     gggggtccac gccgtggaaa caccacgcgg cgcgtgagat tgaagaaccc cttctaccca      1440
     ttgacccaag aatcctacgg agcctatgcg gtcatgtgct tatctgtggt gatctttggg      1500
     accggcatta ttggcaactt ggcagtgatg tgcatcgtgt gtcacaatta ctacatgagg      1560
     agcatctcca attctctctt ggccaacctg gctttctggg actttctcat catcttcttc      1620
     tgcctccccc tggtcatctt ccatgagttg actaagaagt ggcttttgga agatttctcc      1680
     tgcaagatcg tgcccaatat cgaggtggct tctctgggtg tcactacctt caccttatgt      1740
     gcactgtgca tagatcgctt ccgggctgcc accaacgtcc agatgtacta tgaaatgatt      1800
     gaaaattgct cttccaccac tgccaaactt gccgttatct gggttggagc tctgcttttg      1860
     gcccttccgg aagttgtcct ccgccagctg agcaaggaag atttgggctt tagtggccag      1920
     gctcctgcag aacggtgtgt cataaagatc tctcctgatt taccggacac aatctatgtt      1980
     ttggctctca cctatgatgg tgcaaggctt tggtggtatt ttggctgcta cttttgtctg      2040
     cccacacttt tcaccatcac ctgctctcta gtgactgctc ggaagatccg caaagcggag      2100
     aaggccagta cccgtggaaa caagcggcag atccatctag agagccagat gaactgcaca      2160
     gtggtggctc tgaccatttt atatgggttt tgcatcatcc ctgagaatat ctgcaacatt      2220
     gtcactgcct acatggccac gggcgtctct cagcagacca tggacctgct caacatcatc      2280
     agccagttcc ttttgttttt caagtcctgt gtcacccccg tgctcctctt ctgcctctgc      2340
     agacccttca gcagggcctt catggagtgc tactgctgct gctgtgagga gtgtatccag      2400
     aagtcttcca ctgtgaccag tgacgacaac gacaacgagt acaccacaga gctggagctg      2460
     tcgcccttca gtactatccg cagggagatg tccacttttg cttctgtggg gaatcattgc      2520
     tgaaggaacg gcttggttag ctctgatttc ttcgattttc atattctgtg aaaattttta      2580
     ctccatattt ttccttacag gggaacaatg cacacatttt gaaaagcaag tagaggaaga      2640
     catattaact actctagaac tgattttgca aattaatatt tgtgctctgg gaaaaaatgt      2700
     ttctatttag ttatgtaaga agaaggaggc caacagtctc agatcatttt tttctgctat      2760
     ggtgctaata ttttattcaa aagttattgc accttaacaa tattaattgt ttgatttctt      2820
     tctttctttt aaaaacataa tcgttgtata ttgaaggcag gcccgggatt ttgctagtta      2880
     ttttgtgttt gagttgtgat tggaagtaca ttgtatttga aatggtttgt tttttccagc      2940
     catgcaactt agcaccaaat aaacttctca tccttcttt                             2979
//