spacer

EBI Dbfetch

ID   AK032438; SV 1; linear; mRNA; HTC; MUS; 4059 BP.
XX
AC   AK032438;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male olfactory brain cDNA, RIKEN full-length enriched
DE   library, clone:6430546I09 product:EAG K+ CHANNEL, ISOFORM 2 homolog [Rattus
DE   norvegicus] (Kcnh5), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4059
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 17a93219b5e2f1544cdaee999d609444.
DR   Ensembl-Gn; ENSMUSG00000034402; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042299; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6430546I09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4059
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6430546I09"
FT                   /tissue_type="olfactory brain"
FT                   /db_xref="taxon:10090"
FT   CDS             806..3772
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="EAG K+ CHANNEL, ISOFORM 2 homolog [Rattus
FT                   norvegicus] (Kcnh5) (SPTR|Q9EPI9, evidence: FASTY, 99.3%ID,
FT                   100%length, match=2964)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q920E3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR003949"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:3584508"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920E3"
FT                   /protein_id="BAC27869.1"
FT                   /translation="MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSND
FT                   GFCKLSGYHRADVMQKSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTP
FT                   VWFYMQIAPIRNEHEKVVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVL
FT                   QQLTPMNKTETVHKHSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVIL
FT                   ILTFYTAIMVPYNVSFKTKQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDP
FT                   KLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDH
FT                   YLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEVTNTIQIDSWLYQLALSIGTP
FT                   YRYNTSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFSVAMMMVGSL
FT                   LYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYIVSTWSMSK
FT                   GIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFQLASDGCLRALAVEFQTIHCAPGDL
FT                   IYHAGESVDALCFVVSGSLEVIQDEEVVAILGKGDVFGDIFWKETTLAHACANVRALTY
FT                   CDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEERLRQKN
FT                   EVTLSIPVDHPVRKLFQKFKQQKELRIQGSAQSDPERSQLQVESRPLQNGASITGTSVV
FT                   TVSQITPIQTSLAYVKTSESLKQNNRDAMELKPNGGAEPKCLKVNSPIRMKNGNGKGWL
FT                   RLKNNMGAQEEKKEDWNNVTKAESMGLLSEDPKGSDSENSVTKNPLRKTDSCDSGITKS
FT                   DLRLDKAGEARSPLEHSPSQADVKHSFYPIPEQALQTTLQEVKHELKEDIQLLSCRMTA
FT                   LEKQVAEILKLLSEKSVPQTSSPKPQIPLQVPPQIPCQDIFSVSRPESPESDKDEINF"
FT   polyA_signal    4034..4039
FT                   /note="putative"
FT   polyA_site      4059
FT                   /note="putative"
XX
SQ   Sequence 4059 BP; 1070 A; 998 C; 1011 G; 980 T; 0 other;
     gagtctgggc taaagcagga gccctcttgc atctcagccc caggacccga gtcctccgga        60
     gctgctgggg tttcggacag cggcagcagg agaagctgag atgtgacctg ctctccccag       120
     agattgccat ttccctctct ggtgcctgcc tcgcgaacaa cagcccgcac cagccagcga       180
     gcacttgtct ggatcttcct ggagaaagga gcagccacta ggcgctcgca aagcctggac       240
     agaactttgg ctgccctggg tagctgtgaa acagctgagt gagaagggtg ggctaggaga       300
     ccaagggagc agagagctaa ggaatggggt cttagcctgg gctaggggtg gggagaggga       360
     agtcgagttg ctcctcgctc tctcccagag cccgggcgcg gggcagaggg agaaatgctg       420
     agcccgcgtc cgggctcctg cctccccagc agcatcttca gcagcagcct cagcatcagc       480
     accggcggga cagcgacagc gggggcggcg caggcgcact gtgcccggcg gagcctgcag       540
     ttccccagcc ccgtgtgcgg caccaccaca gtctgggcag cggcggccgg gggagcgcta       600
     ctaccatgaa ctgcttggtc ctccttccca gagctgctca tccgggtcgg gctggagaca       660
     cactcagggg accccgccgc cgccgccgcg cccccttttc tttcagcacc atctccacta       720
     ccttttcctc ctcttcttcc accttttctt cctgcttccc cccctccccc gccgcggatc       780
     ctggccgctg ctttccagac ccaggatgcc ggggggcaag agagggctgg tggctccgca       840
     gaacacattt ttggagaaca tcgtcaggcg ctccagtgaa tcaagtttct tactgggaaa       900
     tgcccaaatt gtggactggc ctgtagttta tagtaatgac ggtttttgta aactctctgg       960
     atatcatcga gctgacgtca tgcagaaaag cagcacctgc agttttatgt atggagaact      1020
     gaccgacaag aagaccattg agaaagtcag gcagactttt gacaactacg agtcaaactg      1080
     ttttgaagtt cttctgtaca aaaaaaaccg tacccctgtt tggttttaca tgcaaatcgc      1140
     accaataaga aatgaacacg agaaggtggt cttgttcctg tgtacattca aggacattac      1200
     actgttcaaa cagcctatag aggatgactc aacgaaaggt tggacgaagt ttgcccgatt      1260
     gacacgggct ttgacaaata gccgaagtgt tttacagcag cttacaccaa tgaataaaac      1320
     agagacagtc cacaagcatt caagactagc tgaagtgctt cagctgggat cagacatcct      1380
     tcctcagtac aaacaagaag cgccaaagac gccaccacat atcatcttac actattgtgc      1440
     ttttaaaact acttgggatt gggtgatttt aattcttacc ttctacaccg ccatcatggt      1500
     tccttacaat gtttctttca aaacaaagca gaacaatatc gcctggctgg tgctggacag      1560
     tgtggtggac gtgatttttc tggtggacat tgttttaaat tttcacacga cttttgtggg      1620
     gccgggtgga gaggtcattt ctgacccgaa gcttataagg atgaactatc tgaaaacttg      1680
     gtttgtgatt gatctgctgt cttgtttacc ttatgacatc atcaatgcct ttgaaaatgt      1740
     ggatgaggga atcagcagtc tcttcagctc tttaaaggtg gtgcgccttt tacgcctggg      1800
     ccgtgttgct aggaaactgg accattacct ggaatatgga gcagcggtcc ttgtgctcct      1860
     ggtatgtgtg tttggactgg tggctcactg gctggcttgc atctggtaca gcattggaga      1920
     ctatgaggtc attgatgaag tcaccaacac cattcaaata gacagctggc tctaccagtt      1980
     ggccttgagc attgggaccc catatcgcta caatacgagt gcagggatct gggaaggagg      2040
     acccagcaag gactccctgt atgtgtcctc cctctacttc accatgacga gccttacaac      2100
     cataggattt ggaaacatag ctccgaccac agacgtggag aagatgttct cagtggccat      2160
     gatgatggtc ggctctcttc tttatgcaac tatttttgga aatgttacca caattttcca      2220
     gcaaatgtat gccaacacca accgttacca tgagatgctg aataatgttc gagatttcct      2280
     gaaattatat caggtcccaa aaggccttag tgaacgagtg atggattata ttgtctcaac      2340
     atggtcaatg tcaaaaggca tcgacacaga gaaggtcctc tccatctgtc ccaaggacat      2400
     gagagctgac atctgtgttc atctgaaccg gaaggttttt aatgaacatc ctgcattcca      2460
     attggccagc gatggatgtc tgcgtgcctt ggcagtggag ttccaaacca ttcactgtgc      2520
     tcctggggac ctgatttacc atgctggaga gagtgtggat gccctctgct ttgtggtgtc      2580
     cgggtccttg gaagttatcc aggatgagga ggtggtggcc attttaggga aaggtgacgt      2640
     gtttggagac atcttctgga aggaaaccac ccttgctcat gcgtgtgcca atgtccgggc      2700
     cctgacttac tgtgatctgc acatcatcaa gcgagaagcc ttgctcaagg tccttgactt      2760
     ctatacagca tttgcaaact cattttccag gaacctcact ctcacttgca atctaaggaa      2820
     gcggatcatc ttccgtaaaa ttagtgatgt gaagaaggag gaggaggagc ggctgcggca      2880
     gaagaatgag gtgactctga gcatccccgt ggaccaccca gtgaggaagc tcttccagaa      2940
     gttcaaacag cagaaagaac tgaggatcca gggctctgca cagagtgatc ctgagaggag      3000
     ccagcttcag gtagagagcc gccctttgca gaacggagcc tccatcacag gtaccagtgt      3060
     ggtcaccgta tcacagatta cccccatcca gacgtctctg gcgtatgtga aaaccagcga      3120
     gtctcttaag cagaacaacc gcgatgccat ggaactgaag cccaatggtg gcgctgaacc      3180
     caaatgtctc aaggtcaaca gccccatcag gatgaaaaac ggaaatggga aggggtggct      3240
     gagactcaag aacaacatgg gggctcagga ggagaaaaag gaagactgga ataatgtcac      3300
     caaagccgag tcgatggggc tcttgtcgga ggaccccaag ggcagtgact cagagaacag      3360
     tgtgaccaag aaccccttaa ggaaaacgga ttcttgtgac agtgggatta caaaaagtga      3420
     ccttcgtttg gataaagccg gtgaggcccg aagtcctcta gaacacagcc ccagccaggc      3480
     tgatgtcaag cattctttct accccatccc cgagcaggcc ttacaaacca cactgcagga      3540
     agtcaaacat gaactcaagg aggatatcca gctgctaagc tgcagaatga ctgccctgga      3600
     aaagcaggtg gcagagattt taaaactact ctcagagaaa agcgtacccc agacatcttc      3660
     tccaaaaccc caaattccac tccaagtacc tccccaaata ccatgtcagg atatttttag      3720
     tgtctcaagg cctgagtcac ccgaatctga caaagacgaa atcaactttt aatatatata      3780
     tacatatata tttgttaata tatttaaaac agtatataca tctatataca taagtgtgta      3840
     tatatagtat atacatatat attttcactt gctttcaata tgatgaacac aatatggatt      3900
     ttgatatgta catactgcat gtccagctgg attctggcct gccaaagaca attattcaaa      3960
     acatagatat tgcttgtaca ttatgcagtt gactgcatgc acactttaca tttatttata      4020
     atctctattc tgtaataaaa aaaaagtatg aattttgtt                             4059
//


spacer
spacer