spacer

EBI Dbfetch

ID   AK031757; SV 1; linear; mRNA; HTC; MUS; 2840 BP.
XX
AC   AK031757;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 16)
XX
DE   Mus musculus 11 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:6230407N21 product:septin 9, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2840
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a92f739a2571fe8c7f44388e78dcfb31.
DR   Ensembl-Gn; ENSMUSG00000059248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093907; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106349; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6230407N21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2840
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="11 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6230407N21"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             67..1071
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="septin 9 (MGD|MGI:1858222 GB|NM_017380, evidence:
FT                   BLASTN, 99%, match=2790)"
FT                   /db_xref="GOA:Q80UG5"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858222"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80UG5"
FT                   /protein_id="BAC27538.1"
FT                   /translation="MADNPRDAMLKQAPASRNEKAPMEFGYVGIDSILEQMRRKAMKQG
FT                   FEFNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVR
FT                   MKLTVIDTPGFGDHINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYF
FT                   IPATGHSLRPLDIEFMKRLSKVVNIVPVIAKADTLTLEERVYFKQRITADLLSNGIDVY
FT                   PQKEFDEDAEDRLVNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCE
FT                   FAYLRDLLIRTHMQNIKDITSNIHFEAYRVKRLNEGNSAMANGIEKEPEAQEM"
XX
SQ   Sequence 2840 BP; 682 A; 794 C; 753 G; 611 T; 0 other;
     gagcgtccag gcagcccgac tttcagctgc tgggactccg aggtgactcc cagctgtgtt        60
     ggcgacatgg ctgacaaccc tagagatgcc atgctcaagc aggcccccgc gtcacggaac       120
     gaaaaggccc ccatggagtt cggctatgtg gggatcgact ccatcctgga gcagatgcgc       180
     aggaaggcta tgaaacaggg cttcgagttt aacatcatgg tggttgggca gagcggcctc       240
     gggaagtcca ctttaatcaa taccctcttc aagtccaaaa tcagccggaa gtcggtgcag       300
     cccacctcgg aggaacgcat ccccaagacg atcgaaatca agtcgatcac ccacgatatt       360
     gaagagaagg gggttcgaat gaagctgaca gtgattgaca cgccgggctt cggagaccac       420
     atcaacaatg agaactgctg gcagcccatt atgaagttca tcaatgacca atatgagaag       480
     tacctgcagg aggaagtcaa catcaaccgg aagaagcgca ttcccgacac ccgtgtccac       540
     tgctgcctct acttcatccc agccaccggc cactcgctca ggcccctgga cattgaattc       600
     atgaagcgcc taagcaaagt ggtgaacatt gtcccagtca tcgccaaggc tgacacgctg       660
     accctggagg agagggtcta cttcaaacag cggatcactg cagacctgct gtccaacggc       720
     attgacgtgt acccgcagaa ggagtttgat gaggacgcag aagaccggct ggtgaacgaa       780
     aagttccggg agatgatccc atttgctgtg gtgggcagcg accatgagta tcaagtcaat       840
     ggcaagagga ttctgggaag gaagaccaag tggggcacta tcgaagttga gaataccact       900
     cactgtgaat ttgcttacct gcgggatctc cttatcagga cgcacatgca aaacatcaaa       960
     gacatcacca gcaacatcca cttcgaagcc taccgagtga aacgcctcaa cgagggcaac      1020
     agcgccatgg ccaacgggat cgagaaggag ccggaagccc aggagatgta gatgcgtccc      1080
     gcccctggac cccaccccca gatcttttca tcatccctgg cccacccacc taccctgtct      1140
     tattttatat aattatctcc ttgtcacctg cctccatcca tctcttccca cactttgcca      1200
     ggtaacaaga gagggtttac ctcccaagtg tgctcttatt ggctgcagca gcagggtggg      1260
     cggggctaag cctgggcttg cctctgtgct ctatttccac ccgggctcag cccctgaggg      1320
     gttagaagag ctatgtgtcc gtcccccgct ctgagttcta agctgaagcc tgtgggggcc      1380
     aagtcctagg gggtgcagag gagcccgtta gaccacaaga ccccatggcc gcagcctcaa      1440
     gcaggttaga gactgcccca aaggaggatg gagctggccg ggtattcctg aaacctcacc      1500
     tgcccctccg ggggcgtttc ttacagcgcc ctcagctgcc tgcccctcaa gggaactaga      1560
     ggcgtcacag ccaaagttgc caatcactta gacaaagtga caaccgtgcc cctcgagctt      1620
     gtcccagagc agaaagtacc ttgatctaca agagccagtc acctcttccc agatgtccct      1680
     ttgggtgaaa agcagggacg tgctggagag agggaggtat cttttctccc tcgcccttgg      1740
     gttctctctc ccctgtgctg tagatatcgc tactacactg ggctttaatt ataaaagacg      1800
     aagcgtgaaa gatgctcccc gatgttagga agccccgccc ccaatgtaag gaaggtcaaa      1860
     gcaagaagat gagtcgaagc catgagggag gaagccgtgg aagggaggca taagagtgtg      1920
     tgggagctct cctgcccagg tgccgcggaa ggcatatccg cgtggtcctc agtttgggcc      1980
     aagatattct ggttacattg atgctccgct gcctcaccct gtcccacccc acacacccca      2040
     ggctcaagcc ttgatgattc agtgactgta ctgggtggga gccagaaacc tgaccatttt      2100
     gttgtctaca tgagcctaga ctagccctgt gccccagaac ccatcaaaaa tacccctaaa      2160
     gagggaaaga tgagggggtc agagatggat agccaggctc actcatcttc tctcagaggg      2220
     aacattaggg accatccatg cacagctgac caaagccgtg tccttcctgc ctgcctccca      2280
     ttctcatttg cccctgagga gaaagtttgg tgaggtgcgt taggttggac ccgcttgggg      2340
     aaggtgcctc tacagaccca gggctagctt tctgcagccc agaagtgcag tgggaggggt      2400
     ggggtgcaga cagatggaga cgaacattgt ttcctgcttt gggcgtctac tccctcatcc      2460
     aagcatggaa gggcccctcg tcatgccctg tggccgaaca gttcgcttgc cagcttgcca      2520
     agttcttttg ccaaaatcag gactttgaag gaaatctcca gcacgctgga cccagggcac      2580
     tccggccttc accagcccaa gtgaccctgg ggatttagca gcaacccggt catcaggatg      2640
     actttgtgcc tctgtaacca ggtattgaaa ctgttcgtct caccaggccg gtccacgtgg      2700
     ccctctgctg ggggcttcct ggtggggggg cagaaaagtc tctctctctc tctctctctc      2760
     tttttttttt tttgtataaa taacaaagtg ttgaaatgta tttcctgaaa taaatgtttc      2820
     aaatacaaac tttttttctg                                                  2840
//


spacer
spacer