spacer

EBI Dbfetch

ID   AK031446; SV 1; linear; mRNA; HTC; MUS; 4241 BP.
XX
AC   AK031446;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 13 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:6030433D05 product:membrane metallo endopeptidase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4241
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5efae9d2969c7245ac4e5047561fa89d.
DR   Ensembl-Gn; ENSMUSG00000027820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194134; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6030433D05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4241
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6030433D05"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             90..2342
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="membrane metallo endopeptidase (MGD|MGI:97004
FT                   GB|NM_008604, evidence: BLASTN, 99%, match=2253)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61391"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR029727"
FT                   /db_xref="MGI:MGI:97004"
FT                   /db_xref="PDB:2YVC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61391"
FT                   /protein_id="BAC27410.1"
FT                   /translation="MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTM
FT                   IALYATYDDGICKSSDCIKSAARLIQNMDASVEPCTDFFKYACGGWLKRNVIPETSSRY
FT                   SNFDILRDELEVILKDVLQEPKTEDIVAVQKAKTLYRSCINESAIDSRGGQPLLKLLPD
FT                   IYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDKNSTQHIIHFDQP
FT                   RLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELEK
FT                   EIANATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQN
FT                   EEEVVVYAPEYLTKLKPILTKYSPRDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALY
FT                   GTTSETATWRRCANYVNGNMENAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDL
FT                   TWMDAETKKKAEEKALAIKERIGYPDDIISNENKLNNEYLELNYREDEYFENIIQNLKF
FT                   SQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGILQPPFFSAQQSNSLNYG
FT                   GIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFSWDLAG
FT                   GQHLNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVW
FT                   CGTYRPEYAVNSIKTDVHSPGNFRIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW"
XX
SQ   Sequence 4241 BP; 1310 A; 857 C; 856 G; 1218 T; 0 other;
     gcccactggt gagtcaccgg agagcgaaca accgggcacc gggagcgggg caccagtgtc        60
     cccggggcgc cgggagtcga ttttaggtga tgggaagatc agaaagtcag atggatataa       120
     ctgatatcaa tgctccaaag ccaaagaaga aacagcgatg gactcccctg gagatcagcc       180
     tctctgtgct tgtcttgctc ctgactatca tagcggtgac aatgatcgct ctctatgcaa       240
     cctatgatga tggcatttgc aaatcatcag actgcataaa atcagctgct cgactgattc       300
     agaatatgga tgcctctgtt gagccatgta cagacttctt caagtatgct tgtggaggct       360
     ggttgaaacg caacgtcatt cccgagacca gttcccgata cagtaatttt gacattttaa       420
     gagatgagct agaagtcatt ttgaaagatg tccttcaaga acccaaaact gaagacatag       480
     tagcagtgca gaaagcaaaa accttgtaca gatcgtgtat aaatgagtct gctattgata       540
     gcagaggcgg acaacctcta ctcaaactgt taccagatat atatgggtgg ccagtagcat       600
     cagataactg ggatcaaaca tatggcactt cttggacagc tgagaaatcc attgcacaac       660
     tgaattctaa atatgggaaa aaggtcctca ttaatttttt tgttggcact gatgataaga       720
     attctaccca gcatataatt cattttgacc agcctcgact tggcctccct tccagagact       780
     actatgagtg cactggaata tataaagagg cttgcacagc atatgtggat tttatgattt       840
     ctgtggccag actgattcgt caggaacaaa gtttgcctat tgatgaaaac cagctctctt       900
     tggaaatgaa taaagttatg gaattggaaa aagaaattgc caatgctaca actaaaccag       960
     aagaccgaaa tgacccaatg ctgctttata acaaaatgac attggccaag ctgcagaaca      1020
     acttttccct ggaggtcaat gggaagtcat tcagctggtc aaatttcaca aatgaaatca      1080
     tgtcaactgt gaatattaat attcaaaatg aggaagaagt tgttgtctat gctccagaat      1140
     atttaaccaa acttaagcct attcttacca aatattctcc cagagatctt caaaatttaa      1200
     tgtcctggag gttcataatg gatcttgtaa gcagcctcag ccgaaactac aaggagtcca      1260
     gaaatgcttt ccgcaaggcc ctttatggga ctacatcaga aactgcaaca tggagacggt      1320
     gtgctaacta cgtcaatggg aatatggaga atgctgtggg gaggctttat gtggaagcgg      1380
     cttttgctgg agagagcaag cacgtggttg aagacttgat tgcacaaatc cgggaagttt      1440
     ttattcagac tttggatgac cttacttgga tggatgctga gacaaaaaag aaagctgaag      1500
     aaaaggcctt ggcaattaaa gaaaggattg gctatcctga tgacatcatt tccaatgaga      1560
     acaaactgaa taatgagtat cttgagttga actacaggga agatgaatac tttgagaaca      1620
     taattcaaaa tttgaaattc agccaaagca agcagctaaa gaagctccga gaaaaagtgg      1680
     acaaagatga gtggataagt ggagcagctg tagtcaatgc attttattcc tcaggccgaa      1740
     atcagatagt cttccccgct ggcattttgc agcccccatt cttcagtgct cagcaatcca      1800
     actcattgaa ctatgggggc atcggcatgg tcattggaca tgaaatcaca catggatttg      1860
     atgacaatgg aagaaatttc aataaagatg gagacctcgt tgactggtgg acgcagcagt      1920
     cggcaaataa ttttaaagac caatcccagt gtatggtata ccagtatgga aacttttcct      1980
     gggacctagc aggtggacag catctcaatg gaattaatac actaggagaa aacattgctg      2040
     ataatggagg tattggccaa gcatacagag cctatcagaa ttatgttaaa aagaatggtg      2100
     aagaaaaatt actccctgga cttgacctca atcacaaaca actatttttc ctgaactttg      2160
     cccaggtgtg gtgtgggacc taccggccag agtatgcagt caattctatt aaaacagatg      2220
     tacacagtcc tggaaatttc aggatcattg ggactttgca gaactctgcc gagtttgcag      2280
     atgcctttca ttgccgcaag aattcataca tgaatccaga aaggaaatgt cgggtttggt      2340
     gatcttcaca agatactgaa catccacggc aagatttgcc aaagccacgg aaacaggaac      2400
     tcttccctca gagaaactgg gccccggaag tttcttcagc ttcctggggg gcaattcaca      2460
     gagacgagca tgagctaaca taaatgaaat tagattatta aatctgctgt gaatgaaagg      2520
     ggagggagcc tacgatctag caaatcaatc acttcactgt gtaaataatg attactttcc      2580
     aacggtagta ctaccgttca cttctgtttc tcacacagac tgcagctttc atgttgtctg      2640
     tagagaacag tgttaacact taaagcagac tatgacttct gatcaaaagg aggacgatgc      2700
     tcagtacagc agggcaccaa agcacagatt tgcccctcag cactcacttt tgtttgcaac      2760
     attcatgctc cttccaaact ctcccaaaga actcccatac agactgtggc cttcaggctc      2820
     gtgcagtttt gaactcattt taccatacat aagttattca ttcatcccac atcaatttag      2880
     tttgaacact cttagagctt aaactagagt atctgaaacg gttcccctat ttcacccact      2940
     ttagtgatgt tgagattctt gaacccccct gcagatcttt gagcaatttc ttgctcttgc      3000
     tgcccctcag actcagtctt ttaaaggatt tgtagtaatg tataaagaat aattctatat      3060
     ttaattatta actacattta tgactgaata aaccattgct ataggtaatc attgaatatt      3120
     gaagttatat ggccaagata gttttgaaga tctgtaacat gatatacaga cgaaaatttg      3180
     agactcttta aatctgtaaa tcatattgat gaaaagcttt aagtacaaac tctgggggtg      3240
     agcattacca ttggacgggt gtcttgagat acataatagt tgtggtttac aaacagcatt      3300
     ttcaagatta agtctgtccc tagtggctaa gaaagggtct aactgtatct gtgttgctcc      3360
     atgaatgctt agccttcagg tttgtcatca gatgaaaata ttttgataat aaattgacgt      3420
     tgtgagcccc ttactaggcc tgtgtgcacg ccatgccacc tagctttaga aagcctatgt      3480
     ctgaatcgag atgggcagcc tccactgtac ctgcttcttg aattctacag ctcatggact      3540
     ctaattggat ttcctgaggc actcatatgc cttccttgtc cttctgctta ctttagtgat      3600
     tttcactatt cagtataaat tttacaaaga ttcatttcta cagtccttat ttttatcaaa      3660
     aggtgaaaat gaaaacattt ctatccaaac tcttagtttt catgccttgt gagaaaagcc      3720
     cacttgcttg taaaagtgtt acagtacaat atgtaaaatt gtatagaaca aaaactacag      3780
     ttcagcgaac tgatattctc tgaacacagc accctagcta aaatctataa gaaatggaac      3840
     actgtagctt tctgccatca tcatataact gctaggcata cattatccag atctccagca      3900
     ttatgcacta gctctgcccc attttgtctt tcagtcatgc attacttcct atcttacttc      3960
     tctctgcctt acatttgtaa aatttagctg tatgattggt ttatatgtga atctatcatt      4020
     gttgaataag gttctgttgt gtgactatac tacaaatatt ccatcttatt attgatggac      4080
     ttttaaggac tccatgaact cctgtctatt ctggttttgg attgttacaa atgatataac      4140
     tatgcattat gaactgtgct tatatattca cctttacttg aattatcatt ggaatcactt      4200
     tcccaaacct atccaaaact atcataaatt ttaaagacac g                          4241
//


spacer
spacer