Dbfetch

ID   AK030589; SV 1; linear; mRNA; HTC; MUS; 2116 BP.
XX
AC   AK030589;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male pituitary gland cDNA, RIKEN full-length enriched
DE   library, clone:5330435I08 product:LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
DE   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2116
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 33dbd75fe8dd20a33d3ed9fae814d3ba.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022250; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022282; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021573; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022019; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022145; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022145; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022742; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021314; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021623; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042499; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042459; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042424; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042187; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042284; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042098; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042253; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042219; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042322; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042979; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041870; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041579; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5330435I08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2116
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5330435I08"
FT                   /tissue_type="pituitary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             144..1613
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR
FT                   (LIPOCALIN-INTERACTING PROTEIN) homolog [Homo sapiens]
FT                   (SPTR|Q969J4, evidence: FASTY, 95.1%ID, 100%length,
FT                   match=1467)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="BAC27033.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
FT   regulatory      2098..2103
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2116
FT                   /note="putative"
XX
SQ   Sequence 2116 BP; 388 A; 611 C; 601 G; 516 T; 0 other;
     gagattacct tgagtttccg tcacgggcag cgaggagagg cgcttaggct gggtccgggt        60
     gcttggcggg cggcggcggc ctcatccccg ctcgtcctcc ccgggcccgg agacaccccc       120
     gccccagtca tgctgagcag agtatggaag cagctgacta cgaagtgcta tccgtgcgag       180
     aacagctgtt ccacgacagg gtccgcgagt gcatcatctc aatacttctg tttgcaacac       240
     tctacatcct ctgccatatc ttcctgaccc gcttcaagaa gcctgctgag ttcaccacag       300
     tggatgatga agatgccaca gttaacaaga ttgcgctgga gctgtgcacc tttaccctgg       360
     cggtcgccct gggcgccgtc ttactcctgc ccttctccat catcagcaac gaggtgctgc       420
     tctcgttgcc acgcaactac tacatccagt ggctcaatgg ctccctcatc catggtctgt       480
     ggaacctcgt tttcctcttc tccaatctgt ccctcgtctt ccttatgccc tttgcatatt       540
     tcttcacaga gtctgaaggc tttgctggct ccagaaaggg tgtcctgggc cgggtctacg       600
     agacagtggt gatgttgatc ctcctcacgc tgcttgtgct gggcatggtg tgggtggcat       660
     ccgccattgt agacaatgac aaggccagca gggagtcgct ctacgacttc tgggagtact       720
     acctccccta tctctactcc tgtatctcct tcctcggagt tctgctgctt ctggtgtgca       780
     ctccactagg tctcgcccgc atgttctctg tcactgggaa gttgctggtc aagccccggc       840
     tactggaaga cctggaggaa cagctgaact gctcagcctt tgaggaggca gctctgactc       900
     gaagaatctg caatcccacc tcctgctggc tgccactgga catggaactg ctgcatagac       960
     aggtcctggc tctgcaggca cagagggtcc tcttggaaaa gcgtcggaag gcgtcagcct      1020
     ggcaacggaa cctgggctac cctctggcca tgctgtgctt gctggtgctg acgggcctgt      1080
     ctgtcctcat cgtggctgtc cacatcctgg agctgcttat tgacgaggct gccatgccac      1140
     ggggcatgca ggatgctgcc ctaggccagg cctccttctc caaactggga tcctttggcg      1200
     ccatcatcca ggttgtgctg atattttacc tgatggtgtc ctcagtggtg ggtttctaca      1260
     gctctccact ctttggaagc ctgaggccta ggtggcatga cacatcgatg acacagatca      1320
     ttgggaactg tgtctgcctc ctggtcctca gctcagcact tcctgtcttc tctagaactc      1380
     ttggcctgac acgctttgac ctgctgggtg actttggacg cttcaactgg ctaggcaatt      1440
     tctacatcgt gttcctctac aacgcagcct ttgctggcct caccacactc tgtctggtga      1500
     agaccttcac ggcagctgtg agggcagagc tgatccgagc ctttgggctg gacagactgc      1560
     cactgcctgt ctctgggttt ccccgggctt ctaggaagaa gcagcatcaa tgacctccag      1620
     ctgggggctg agaaggagag aactgggcag tgcctaggcc tggcggtgag ccccaggggg      1680
     ctgcacctca ggacctggaa cctgagagta ggtgacagag gggacggacc atctgcactg      1740
     ttgcttaatc tgagccagag tttgggaccc ggctggcctc ctgccttttc agatgtagct      1800
     gtggcctgag catccatctg gtggagctgg gggactcgct ctagttcctg gacccaaata      1860
     cgtttacaca tctatctgcc tcaatcctgt tccaggccat gcctgaagcc atgtttacat      1920
     gatttgatgt gcaatagggt gggtgggact tggggggact gggccagggg taggttctgg      1980
     agacaggtct tccttgcctc tggcccagaa gagccgaagc actgtgctat cctgtggagg      2040
     gctttggacc actggagaga ccaagggtgc tgggaggagg cggctgcacc cacgagcaat      2100
     aaaattgatc ccaggg                                                      2116
//