spacer

EBI Dbfetch

ID   AK030536; SV 1; linear; mRNA; HTC; MUS; 2115 BP.
XX
AC   AK030536;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male pituitary gland cDNA, RIKEN full-length enriched
DE   library, clone:5330428J18 product:regulator of G-protein signaling 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2115
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b88a5e27bf1a34e02ce9cb66002968a1.
DR   Ensembl-Gn; ENSMUSG00000038530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027991; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5330428J18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2115
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5330428J18"
FT                   /tissue_type="pituitary gland"
FT                   /db_xref="taxon:10090"
FT   CDS             121..738
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signaling 4 (MGD|MGI:108409
FT                   GB|NM_009062, evidence: BLASTN, 99%, match=630)"
FT                   /db_xref="GOA:Q5D078"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:108409"
FT                   /db_xref="UniProtKB/TrEMBL:Q5D078"
FT                   /protein_id="BAC27009.1"
FT                   /translation="MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHSSSHSKKDKV
FT                   VTCQRVSQEEVKKWAESLENLIHHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSP
FT                   SKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLQPTITCFDEAQKKIFNLMEKD
FT                   SYRRFLKSRFYLDLTNPSSCGAEKQKGAKSSADCTSLVSQCA"
XX
SQ   Sequence 2115 BP; 579 A; 474 C; 495 G; 567 T; 0 other;
     gagaggctca gaggattctg acagcttctt tgcagagcag aagcaactgt gctcaaaata        60
     gaaaccaccg cggctcccgc tgcctttctc tcctcgctaa gaatccctca gttaaacaag       120
     atgtgcaaag gacttgcagg tctgccggct tcctgcctga ggagtgcaaa ggacatgaaa       180
     catcggctgg ggttcctgct gcagaagtca gattcctgcg aacacagttc ttcacacagc       240
     aagaaggaca aagtagtaac ttgccagagg gtaagccaag aagaagtcaa gaaatgggct       300
     gaatcgttgg aaaacctgat tcaccatgaa tgtggactgg cagctttcaa agctttcctg       360
     aagtcggaat acagcgagga gaacattgac ttctggatca gctgtgagga gtacaagaag       420
     atcaagtcac cttctaaact aagtcccaaa gccaagaaga tctacaacga gttcatctca       480
     gtgcaagcaa caaaagaggt gaacctggac tcttgcacca gagaggagac aagccggaac       540
     atgttacagc ccacaataac ctgttttgat gaagcccaga agaagatttt caacctgatg       600
     gaaaaggatt cctaccgccg cttcctcaag tctcgattct atcttgacct gaccaatcct       660
     tccagctgcg gggcagagaa gcagaaagga gccaagagtt ctgcagactg cacttccctg       720
     gtctcccagt gtgcctaatt ctcacacaga ggcagggagc ccaaatgcca agactctatg       780
     ctctgaaaaa cctgaggcca aatattgatc ttaagcacca atgctttatc cacattgtag       840
     cctagtgtcc atgctgcctg ccgcgtgtga gtcacttcca tgtaaaacta gccttagttg       900
     tggtgttggg gttttcacta gggtaagacc caatttgttt taaattttcc caagtctcct       960
     taagggtgag caagtttcca aataatggct ccgtaggtct ggattttcaa agatggctgg      1020
     cagtctgccc ctttcaacag tttgacctca agttagttag ttggtacact tcatgtgaca      1080
     ttccatgcac atgtaatgtt ggccagcagc acttcctacg gactctcaat gtttaggtga      1140
     tatttgtgta tgcatatgta tacattaaaa tatacataac atatgcatat acattctgta      1200
     tatattatac ctatgtattc aatgtgtgtg aatgtgcatg aatatgtatc tatctatcta      1260
     tatatgtata tactgacaca tgcacacaca tttctttaag aaaagatggg aaagatccta      1320
     ggtgctcaaa ctggagtgtg tagacatgct tgcatgcatg ttctgatttc tggtccttca      1380
     taccgtgtct gaacagggca aactgaatta actgccatgc aggctaagaa aggaacagta      1440
     acttgtgggg aatgagttct atagaaccac tgggtcttgg cggagaatag ccagggcctt      1500
     tgtgtttagt tgttgatggc ctccacattg agcactaagc taaggggtga gcactctgaa      1560
     aactctgctg tctgactgac actgaactgc cttgcatcag tgatcactac tggcactttt      1620
     taagtccctc tgctgatggc cttccctcct ttgcctgggt gctcagggtg tgctgattag      1680
     cagctgggtt ggtctagagc tgaatgtttg agctgaatga aggaatgtgg tccaggcttt      1740
     gctgcctagc cctaccaagg actactgctt aggtgagggc agaggaccta aagattatct      1800
     taattctttc ctcttttgat aaggtgctct tcttttcctt cccctcaaga atgtcacctg      1860
     tcagaggagc ctccttagtt ccctgtggtt ggttgttcac tttaaaaacc acggctacct      1920
     gccgtggttc taagctacat gcctacatct gtaaagcatc atcgggggga aaggttatgt      1980
     tttatcagga ggaaggaagt tctcatgaac tgcaaagccc tctttggttt tctgctttga      2040
     ggtaagagct tgttcacccc atcccaaaca ccaaggctag cagagaccaa tgaaaggaga      2100
     gaggaaagga aaaag                                                       2115
//


spacer
spacer