Dbfetch

ID   AK030329; SV 1; linear; mRNA; HTC; MUS; 4016 BP.
XX
AC   AK030329;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 11 days pregnant adult female ovary and uterus cDNA, RIKEN
DE   full-length enriched library, clone:5031438M17 product:type 1 tumor
DE   necrosis factor receptor shedding aminopeptidase regulator, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4016
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 645f4508b3beac2403707888bca8fe7c.
DR   Ensembl-Gn; ENSMUSG00000021583; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020768; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020723; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0020514; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021157; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020032; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020473; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0020598; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0020578; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020671; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020607; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021197; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019785; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020089; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000169114; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037555; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037522; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0037327; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0038030; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0037282; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0037232; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0037378; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0037342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037496; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0037338; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0038085; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0036916; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036727; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5031438M17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4016
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="11 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5031438M17"
FT                   /tissue_type="ovary and uterus"
FT                   /db_xref="taxon:10090"
FT   CDS             77..2869
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="type 1 tumor necrosis factor receptor shedding
FT                   aminopeptidase regulator (MGD|MGI:1933403 GB|NM_030711,
FT                   evidence: BLASTN, 99%, match=2945)"
FT                   /db_xref="GOA:Q9EQH2"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR033520"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="MGI:MGI:1933403"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQH2"
FT                   /protein_id="BAC26904.1"
FT                   /translation="MPSLLPLVLTFLSVSSPSWCQNSDIESLKASNGDSFPWNNMRLPE
FT                   YMTPIHYDLMIHANLSTLTFWGKTEVEIIASRPTSTIIMHSHHLQISKATLRRGAGEML
FT                   SEEPLKVLEYPAHEQVALLAAQPLLAGSLYTVIIDYAANLSESFHGFYKSTYRTQEGEM
FT                   RILAATQFEPTAARMAFPCFDEPALKASFSIKIKRDPRHLAISNMPLVKSVNVAEGLIE
FT                   DHFDITVKMSTYLVAFIISDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEF
FT                   YEDYFNIPYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLYDKEKSSASSKLGITMIV
FT                   SHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEFVSVTVTHPELKVEDYFFGKCFNAMEV
FT                   DALNSSHPVSTPVENPAQIREMFDDVSYEKGACILNMLRDYLSADTFKRGIVQYLQKYS
FT                   YKNTKNEDLWNSMMHICPTDGTQTMDGFCSRSQHSSSTSHWRQEVVDVKTMMNTWTLQK
FT                   GFPLITITVSGRNVHMKQEHYMKGSERFPETGYLWHVPLTFITSKSDSVQRFLLKTKTD
FT                   VLILPEAVQWIKFNVGMNGYYIVHYADDGWASLSGLLKEAHTTISSNDRASLINNAFQL
FT                   VSIEKLSIEKALDLTLYLKNETEIMPIFQALNELIPMYKLMEKRDMIEVETQFKDFLLK
FT                   LLKDLIDKQTWTDEGSVSERMLRSQLLLLACVRNYQPCVQRAERYFREWKSSNGNMSIP
FT                   IDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFK
FT                   GEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQF
FT                   STRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL
FT                   "
FT   regulatory      3997..4002
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4016
FT                   /note="putative"
XX
SQ   Sequence 4016 BP; 1175 A; 820 C; 861 G; 1160 T; 0 other;
     gcagactggc ggctgtgatg aaggtaattt gagcaagaag atagtgtctc tgctcctcaa        60
     atagccactt gcaagcatgc cctctcttct tcccctagta ttgacatttt tatctgtgtc       120
     atctccttct tggtgtcaga acagtgatat agaatctcta aaagctagta atggagactc       180
     attcccttgg aataatatgc gacttcctga gtatatgacc ccgattcatt atgatctcat       240
     gatccatgca aacctcagca ctctgacttt ctggggaaaa acagaagtag aaatcatagc       300
     tagccggccc accagcacca ttattatgca tagtcaccac ctgcaaatat ctaaggccac       360
     cctcagaaga ggagctggag agatgctgtc tgaagaacca ctgaaggtcc tggaatatcc       420
     tgctcatgag caagttgcac tgctggctgc ccagccgctt cttgctgggt ccctgtacac       480
     agttatcatc gactatgctg ccaacctgtc tgagagtttc catggattct ataagagcac       540
     ctacagaaca caggaaggtg aaatgagaat acttgcagca acacagtttg aacccacagc       600
     tgctagaatg gcttttccct gctttgatga acctgccctc aaggcaagtt tttccatcaa       660
     gataaagagg gatccaaggc acctggccat ctccaacatg cccctggtga aatctgtgaa       720
     tgttgctgaa ggactcatag aagaccattt tgacatcact gtgaagatga gtacctacct       780
     agtggccttc atcatttctg attttaagtc tgtgagcaag atgactaaga gtggagtcaa       840
     ggtttctgtg tatgctgtgc cagacaagat aaatcaagcc gattatgctc tggatgctgc       900
     agtgactctt ctagagtttt atgaggatta tttcaacatt ccatatcctt tacccaagca       960
     agatcttgct gcaatcccag actttcagtc tggtgctatg gaaaactggg gactgaccac      1020
     atacagagag tcctctctgt tatacgataa agaaaagtct tctgcatcta gtaagcttgg      1080
     catcacaatg attgtgtccc atgaactggc tcaccagtgg ttcgggaacc tggtcaccat      1140
     ggaatggtgg aatgaccttt ggctcaatga aggatttgcc aaatttatgg agtttgtgtc      1200
     tgtcactgtg acccatcctg aactaaaagt tgaagactat ttctttggca agtgttttaa      1260
     tgcaatggaa gttgatgcat taaactcctc tcaccctgta tccacacctg tggagaatcc      1320
     tgcgcagatt cgggagatgt ttgatgatgt ttcttatgaa aagggagctt gtattctgaa      1380
     tatgctaaga gattatctga gtgcagatac atttaaaaga ggaattgtac agtatctcca      1440
     aaagtatagt tataaaaaca caaaaaacga ggacctgtgg aatagcatga tgcatatttg      1500
     ccctacagat ggcacacaaa caatggatgg cttctgctct agaagccaac actcatcatc      1560
     aacctcacac tggcgtcagg aggttgtaga tgtaaagacc atgatgaaca catggacact      1620
     gcagaagggc tttcctctga taaccatcac tgtgagtggg cggaatgtgc acatgaagca      1680
     agaacactac atgaagggtt cagaacgctt cccagagact gggtatttgt ggcatgttcc      1740
     actgacattc attaccagca aatcagactc agtccagaga tttttgctga agacaaagac      1800
     agatgtgctc atcctcccag aagcagtgca gtggatcaaa tttaacgtgg gaatgaatgg      1860
     ctattacatt gtgcattacg cggatgatgg atgggcttct ctgagtggcc ttttaaaaga      1920
     agcgcacaca acaatcagca gtaatgatcg ggcaagtctc atcaacaatg catttcagct      1980
     ggtcagcatt gaaaagttat caatagaaaa agccctggat ttaaccctgt acttgaaaaa      2040
     tgaaactgaa attatgccca tattccaagc tttgaatgaa ctcataccta tgtataagtt      2100
     aatggagaaa agagatatga ttgaggtgga aactcaattt aaggacttcc ttctcaagtt      2160
     gctgaaggac cttattgata agcagacttg gacagatgaa ggctctgtct cagagaggat      2220
     gctcaggagc cagctcctcc tcctcgcatg tgtgcgcaat tatcagccct gtgtgcagag      2280
     ggcagagcgc tatttcagag agtggaagtc atctaatgga aacatgagca tccctattga      2340
     tgtgaccttg gctgtgtttg ctgtcggggc ccaaaacaca gaaggctggg attttcttta      2400
     tagtaaatat cagtcttctt tgtctagtac tgagaaaagc caaattgaat tttccctctg      2460
     tacaagcaaa gatccagaaa aacttcagtg gcttctagat caaagtttta agggagagat      2520
     aataaaaact caggaatttc cacatattct cacactcatt ggcagaaacc cagtgggtta      2580
     tccattggcc tggaagtttc tgagggaaaa ttggaataag cttgtacaga aatttgaact      2640
     tggctcatcg tccatagctc acatggtaat gggaacaaca gaccagtttt ccaccagagc      2700
     acgtcttgaa gaggtaaaag gattcttcag ttccttgaaa gaaaacggtt ctcagctccg      2760
     ttgtgttcaa caaaccattg agaccattga agaaaacata cgatggatgg ataagaattt      2820
     tgataaaata agactgtggc tgcaaaaaga aaagccagag ttgctgtgac aatatgtttc      2880
     ttgccaagtt ccagaattta tgatgagcaa aattttgttc aatttgagta tttttaaact      2940
     aaagatagtt gttttggcta ctactgaaga tattttctta tttcatttca cttgattatg      3000
     tctgagaaaa gcttcaatga ctgtgattga caggtttaaa cccaagtgcc cagctccttg      3060
     ccacagaaaa acccaggggg cttcttctca gtttatactt cagcttctgt gtcggccatt      3120
     catcagtatt tttgtaagac tgaatagtga ggcataactg tgcagtgaat gcttggctcc      3180
     ttagccatgc tgggaagtgg ctgtgcagca gccctcctgt tgacctctct ggctctacag      3240
     tcctgcagtc tctcttcctg ggttcactta tgggtgctgc cttgcaggat ccacttaatc      3300
     agacactttt gccctctgga ttttgttaat agtgtttggt agttgttatc catgagggat      3360
     tgcatagagg tgtttatttt cttgtacttg cctctggctg gctttcaagc accgtaagtc      3420
     ttactcctaa gagggggccc tttccccccc cccccccccg cactctgata actacttcct      3480
     tttcatcctt tggggcatgg ggcaacagtg gaaacctgct gataccagtc atggtagtac      3540
     ttgtcatttt cactgaacct acgtgcacat ttgtttttaa aaatattgta tatctataac      3600
     cctcgttgga taagtcaaat atgagagcca cttactttct ttggaaggtt atttttaaaa      3660
     atgcagagtg cattcagatc tgtatcagaa atatctcgtt ttaagatata cttgtgagtc      3720
     actgatccct taagtaggga gtagggttgt aaattcctaa ataactcata atagcactta      3780
     ctgaaaataa atcattgagg actcactaac aaaggacaat attaataata tgtttatatt      3840
     agtataagga aagattcttt aaatcttaaa aagatttttt tgatgtatgg cataaatgat      3900
     aggaaaaata tcaacatatg gtgctgtaat atactatgaa ataaagcgat tttaggggtt      3960
     caattatatt ttcactggcc taccaaaata cttgagatta aatgaggaaa gatttc          4016
//