spacer

EBI Dbfetch

ID   AK029941; SV 1; linear; mRNA; HTC; MUS; 2922 BP.
XX
AC   AK029941;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4932408O05 product:frizzled-related protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2922
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4411ac041f1c651713a024fa816cd896.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4932408O05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2922
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4932408O05"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             559..1530
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="frizzled-related protein (MGD|MGI:892032
FT                   GB|NM_011356, evidence: BLASTN, 99%, match=2510)"
FT                   /note="putative"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="BAC26690.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS"
FT   polyA_signal    2904..2909
FT                   /note="putative"
FT   polyA_site      2922
FT                   /note="putative"
XX
SQ   Sequence 2922 BP; 713 A; 737 C; 700 G; 772 T; 0 other;
     cggctgacct cctctgagct cctctggccg ctcgcaggat cttcccgacc ctgcaggact        60
     tggcaaactc ccacctccgc tcccattagt cctcccaccc ccaccaaatc tcctccctcg       120
     gaggtcccct atccatctca ctttgcagaa tttatcgctt cttccaacac ctttttgcaa       180
     caccccagaa ctccgagtcc cttaactgaa tttgactttt gtttttattt ctctctggct       240
     tcctcttctg ccccctcatc tgattgatgt gctaaggctg atgtctctgc cagagcgaga       300
     ggaataaata gatgctgcct cgcctagagg cttagacgct tgggaagagc agccggcgca       360
     gcgaggcacc gggctccgcc aagctagtgg accggacctg ggagcacttg gatccaagag       420
     aactgtgatt gtcccagggg tgggggcagc tccccaggtc gttgggatca cccctcggaa       480
     ccgcaggggg agacttcgga acgaaagtgt ctcccgcgtc cgtcgctcgg ctgcgccctg       540
     ccccatcctg ctgggaccat ggtctgctgc ggcccgggac ggatgctgct aggatgggcc       600
     gggttgctag tcctggctgc tctctgcctg ctccaggtgc ccggagctca ggctgcagcc       660
     tgtgagcctg tccgcatccc gctgtgcaag tcccttccct ggaacatgac caagatgccc       720
     aaccacctgc accacagcac ccaggctaac gccatcctgg ccatggaaca gttcgaaggg       780
     ctgctgggca cccactgcag cccggatctt ctcttcttcc tctgtgcaat gtacgcaccc       840
     atttgcacca tcgacttcca gcacgagccc atcaagccct gcaagtctgt gtgtgagcgc       900
     gcccgacagg gctgcgagcc cattctcatc aagtaccgcc actcgtggcc ggaaagcttg       960
     gcctgcgacg agctgccggt gtacgaccgc ggcgtgtgca tctctcctga ggccatcgtc      1020
     accgcggacg gagcggattt tcctatggat tcaagtactg gacactgcag aggggcaagc      1080
     agcgaacgtt gcaaatgtaa gcctgtcaga gctacacaga agacctattt ccggaacaat      1140
     tacaactatg tcatccgggc taaagttaaa gaggtaaaga tgaaatgtca tgatgtgacc      1200
     gccgttgtgg aagtgaagga aattctaaag gcatcactgg taaacattcc aagggacacc      1260
     gtcaatcttt ataccacctc tggctgcctc tgtcctccac ttactgtcaa tgaggaatat      1320
     gtcatcatgg gctatgaaga cgaggaacgt tccaggttac tcttggtaga aggctctata      1380
     gctgagaagt ggaaggatcg gcttggtaag aaagtcaagc gctgggatat gaaactccga      1440
     caccttggac tgggtaaaac tgatgctagc gattccactc agaatcagaa gtctggcagg      1500
     aactctaatc cccggccagc acgcagctaa atcctgaaat gtaaaaggcc acacccacgg      1560
     actcccttct aagactggcg ctgctggact aacaaaggaa aaccgcacag ttgtgctcgt      1620
     gaccgattgt ttaccgcaga caccgcgtgg ctaccgaagt tacttccggt cccctttctc      1680
     ctgcttctta atggcctggg gttagatcct ttaatatgtt atatattctg tttcatcaat      1740
     cacgtgggga ctgttctttt gcaaccagaa tagtaaatta aatatgttga tgctaaggtt      1800
     tctgtactgg actccctggg tttaatttgg tgttctgtac cctgattgag aatgcaatgt      1860
     ttcatgtaaa gagagaatcc tggtcatatc tcaagaacta gatattgctg taagacagcc      1920
     tctgctgctg cgcttatagt cttgtgtttg tatgcctttg gccatttccc tcatgctgtg      1980
     aaagttatac atgtttataa aggtagaacg gcattttgaa atcggacact gcacaagcag      2040
     agtagcccaa caccaggaag catttatgag gaaacgccac acagcatgac ttattttcaa      2100
     gattggcagg cagcaaaata aatagtgttg ggagccaaga aaagaatatt ttgcctggtt      2160
     aaggggcaca ctggaatcag tagcccttga gccattaaca gcagtgttct tctggcaacg      2220
     tttttgattt gttcataaat gtattcacga gcattagaga tgaacttata actagacatc      2280
     tgttgttatc actatagctc tgcttccttc taaatcaaac ccattgttgg atgctccctc      2340
     tccattcata aataaatttg gcttgctgta ttggccagga aaagaaagta ttaaagtatg      2400
     catgcatgtg caccagggtg ttatttaaca gaggtatgta actctataaa agactataat      2460
     ttacaggaca cggaaatgtg cacatttgtt tacttttttt cttccttttg ctttgggctt      2520
     gtgattttgg tttttggtgt gtttatgtct gtattttggg gggtgggtag gtttaagcca      2580
     ttgcacattc aagttgaact agattagagt agactaggct cattggccta gacattatga      2640
     tttgaatttg tgttgtttaa tgctccatca agatgtctaa taaaaggaat atggttgtca      2700
     acagagacga caacaacaac aaaaatgttt ttcttatgtg tgctgcactg agaccccaac      2760
     aacccatggg tgggggggaa cccacgatgc cttttcttcc ttccctgcag cagggatgtg      2820
     cccatcacct gaaagtctca ttccctgaaa tttacacatg tggtagtagt aggtccagat      2880
     tcctaagtta cagtgtgctg aaaaataaaa caggtatgaa gc                         2922
//


spacer
spacer