spacer

EBI Dbfetch

ID   AK029849; SV 1; linear; mRNA; HTC; MUS; 5211 BP.
XX
AC   AK029849;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4931412F17 product:SOLUBLE ADENYLYL CYCLASE homolog [Rattus
DE   norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5211
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b20770c7769a0a540ae5bacd10c18166.
DR   Ensembl-Gn; ENSMUSG00000026567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148550; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4931412F17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5211
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4931412F17"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             216..5060
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SOLUBLE ADENYLYL CYCLASE homolog [Rattus norvegicus]
FT                   (SPTR|Q9Z286, evidence: FASTY, 94.5%ID, 98.5%length,
FT                   match=4758)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8C0T9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR016577"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2660854"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8C0T9"
FT                   /protein_id="BAC26642.1"
FT                   /translation="MSARRQELQDRAIVKIAAHLPDLIVYGDFSPERPSVKCFDGVLMF
FT                   VDISGFTAMTEKFSTAMYMDRGAEQLVEILNYYISAIVEKVLIFGGDILKFAGDALLAL
FT                   WKVERKQLKNIITVVIKCSLEIHGLFEAKEAEEGLDIRVKIGLAAGHITMLVFGDETRN
FT                   YFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIERIPDQRAVKVSFLKPPP
FT                   TFNFDEFFTKCMGFMDYYPSGDHKNFLRLACMLESDPELELSLQKYVMEIILKQIDDKQ
FT                   LRGYLSELRPVTIVFVNLMFKEHDKVEVIGSAIQAACVHITSVLKVFRGQINKVFMFDK
FT                   GCSFLCVFGFPGEKAPDEITHALESAVDIFDFCSQVHKIRTVSIGVASGIVFCGIVGHT
FT                   VRHEYTVIGQKVNIAARMMMYYPGIVSCDSVTYDGSNLPAYFFKELPKKVMKGVADPGP
FT                   VYQCLGLNEKVMFGMAYLICNRYEGYPLLGRVREIDYFMSTMKDFLMTNCSRVLMYEGL
FT                   PGYGKSQVLMEIEYLASQHENHRAVAIALTKISFHQNFYTIQILMANVLGLDTCKHYKE
FT                   RQTNLQNRVKTLLDEKFHCLLNDIFHVQFPVSREMSRMSKIRKQKQLEALFMKILAQTV
FT                   REERIIFIIDEAQFVDGTSWAFIEKLIRSMPIFIVMSLAPFSEVPCAAANAIMKNRNTT
FT                   YITLGTMQPQEIRDKVCVDLSVSSIPRELDSYLVEGSCGIPYYCEELLKNLDHHRVLLF
FT                   QQAETEQKTNVTWNNMFKHSVRPTDDMQLFTSISEGQKEVCYLVSGVRLNNLSPPASLK
FT                   EISLVQLDSMSLSHQMLVRCAAIIGLTFTTELLFEILPCWNMKMMIKALATLVESNVFN
FT                   CFRSSKDLQLALKQNVPTFEVHYRSLALKLKEGLTYGEEEELREMEGEVVECRILRFCR
FT                   PIMQKTAYELWLKDQKKVLHLKCARFLEESAHRCNHCRNVDFIPYHHFIVDIRLNTLDM
FT                   DTVKRMVTSQGFKIDEEEAVFSKSELPRKYKFPENLSITEIREKILHFFDNVILKMKSS
FT                   PNDIIPLESCQCKELLQIVILPLAQHFVALEENNKALYYFLELASAYLILGDNYNAYMY
FT                   LGEGERLLKSLTNEDSWSQTFEYATFYSLKAEVCFNMGQMVLAKKMLRKALKLLNRMFP
FT                   CNLLTLTFQMHVEKNRLSHFMNQHTQEGSVPGKKLAQLYLQASCFSLLWRIYSLNFFFH
FT                   YKYYGHLAAMMEMNTSLETQNDFQIIKAYLDFSLYHHLAGYQGVWFKYEILVMEQLLNL
FT                   PLKGEAIEIMAYTADTLGHIKFLMGHLDLAIELGSRAHRMWSLLRNPNKYQMVLCRLSK
FT                   PLFLKSRYKHLVQVLGWLWDLSVTEEDIFSKAFFYFVCLDIMLYSGFIYRTFEECLEFI
FT                   HHNEDNRILKFQSGLLLGLYSCIAVWYARLQEWDNFNKFSDRAKHLVTRRTPTVLYYEG
FT                   ISRYMEGQVLHLQKQIEEQAENAQDSGVEILKALETLVAQNTTGPVFYPRLYHLMAYVC
FT                   ILMGDGHSCDFFLNTALELSETHGNLLEKCWLSMSKEWWYSASELTGDQWLQTVLSLPS
FT                   WDKIVSGKGGQRKRSWSWFCPPNFSMVSWSQPQCA"
FT   polyA_signal    5196..5201
FT                   /note="putative"
FT   polyA_site      5211
FT                   /note="putative"
XX
SQ   Sequence 5211 BP; 1407 A; 1212 C; 1255 G; 1337 T; 0 other;
     gaaaaactgt catttgatgg gtcaggtatg gacagacatg gcacttctgc tgtcttcaga        60
     ataataacac cagacccctt tcctgttctc tgcattcctg aaagatctag tccctaatct       120
     aggctcgagc ttctccacag tcttggagaa cagagaagac ctacttgggg agacagtttc       180
     ctggtgctga aaaatcctga ccattgtcct tgaacatgag tgcgcgaagg caggaattac       240
     aagacagggc aatcgtcaag atagctgctc acttaccaga cctcatcgtc tacggagatt       300
     tctctccgga acggccgtca gtaaaatgtt ttgatggagt tctgatgttt gttgatattt       360
     caggttttac tgcaatgact gagaagttca gcacggccat gtacatggac cgaggagccg       420
     aacagctcgt ggagatcctc aactactaca taagtgccat agtggagaaa gtgctgattt       480
     ttggaggaga catcctaaaa tttgcaggtg atgccttgct ggccctgtgg aaagtggaac       540
     gaaagcaact gaagaacatc atcacggtgg tgattaagtg cagcctggag atccatggct       600
     tgtttgaagc caaggaggct gaagaaggcc tggacattcg agttaagata gggctggctg       660
     ctggccacat caccatgttg gtctttgggg atgaaacacg gaactacttc ctggtgattg       720
     gccaggcggt ggatgatgtc cgccttgctc agaacatggc tcagatgaac gacgttattt       780
     tgtcaccaaa ctgctggcag ctctgtgatc ggagcatgat tgaaattgag aggattccag       840
     atcagagagc agttaaggtt agcttcttaa aaccaccccc aacctttaat tttgacgagt       900
     ttttcacaaa atgtatgggc ttcatggatt attatccttc tggtgaccac aaaaacttcc       960
     taaggcttgc ctgcatgctg gagtctgatc ctgaactcga gctgtctcta caaaagtacg      1020
     tgatggaaat cattttgaag cagatcgatg acaagcagct gcggggctat ttatctgagc      1080
     ttcgccctgt gacaattgtg tttgtgaact tgatgtttaa agagcacgac aaagtagaag      1140
     tcataggctc agccatccaa gctgcctgtg tacacatcac ttctgtcttg aaggtcttcc      1200
     gaggccagat caataaggtc ttcatgtttg ataagggctg ctccttcctc tgtgtcttcg      1260
     gcttccctgg ggaaaaggct cccgatgaga tcactcatgc gctggaaagt gccgtggata      1320
     tatttgactt ctgctcccag gtccacaaaa tccgtactgt ctccatcggt gttgccagtg      1380
     ggattgtctt ctgtgggatc gttggacaca ctgtgagaca tgagtacaca gtcatcggtc      1440
     agaaggtcaa cattgctgcc aggatgatga tgtactaccc gggcatcgtg agctgcgact      1500
     ctgtcaccta cgatggcagc aacctaccag cctacttttt taaggagctt ccgaagaaag      1560
     ttatgaaagg agttgcagat cctggacccg tgtatcagtg tttgggcctc aatgagaaag      1620
     tcatgtttgg tatggcatat ctcatctgca acagatatga gggctaccct ttgctgggac      1680
     gtgttaggga gatcgactat ttcatgtcta ctatgaagga ctttttgatg acgaactgca      1740
     gccgagttct aatgtatgaa ggattaccag gatatggaaa aagccaggta ctcatggaaa      1800
     tcgaatatct ggcctctcag catgagaacc acagggctgt tgctattgca ctgactaaga      1860
     tcagcttcca tcaaaatttt tatactatcc agatactcat ggctaatgta ctaggtctgg      1920
     acacttgtaa acattacaaa gaacgacaga ccaatcttca aaatagagtc aagacgctgt      1980
     tggatgagaa gttccactgt cttcttaatg acatcttcca tgttcagttc cctgtttccc      2040
     gggagatgtc caggatgagc aagataagaa agcagaagca actggaagcc ctgtttatga      2100
     agatcttggc gcaaacagtg agagaagaaa ggattatttt catcatcgat gaggcccagt      2160
     ttgtggatgg aacctcctgg gccttcatag agaagctcat ccgctctatg cccatcttca      2220
     tcgttatgtc cctggctcct ttctctgaag ttccctgtgc agctgccaat gccataatga      2280
     agaaccggaa caccacctac atcacgcttg gtaccatgca gcctcaggaa atccgggaca      2340
     aggtctgtgt tgaccttagt gtaagcagca tccccagaga gctcgactcg tacctggtag      2400
     agggaagctg cgggattccg tattactgtg aagaattgct gaaaaacctc gaccaccaca      2460
     gagttctcct ttttcaacaa gcagagactg agcaaaagac aaacgtgacc tggaataaca      2520
     tgttcaagca ctctgttagg ccaacagatg acatgcaact tttcacttcc atatctgagg      2580
     ggcagaaaga agtctgttac cttgtgagtg gtgtcaggct gaataatttg tcacctccag      2640
     catcgctaaa agagatatct ctggtccagc tggacagcat gagcctttcc catcagatgc      2700
     tggtgagatg cgctgccatc attggcctaa ccttcaccac ggagctgctg tttgagattc      2760
     tcccctgctg gaacatgaag atgatgatca aggccctggc caccctagtg gaatcaaatg      2820
     ttttcaattg cttccggagt agcaaagatc ttcaactagc cttaaaacaa aatgtgccaa      2880
     catttgaggt tcattatcgc tctttggccc tgaagctcaa ggaagggtta acttacggcg      2940
     aagaggagga gctccgtgag atggaaggag aggtggttga gtgccggatc cttcggttct      3000
     gcagacccat aatgcagaag acagcctacg aactgtggct caaggaccag aagaaagtct      3060
     tgcatctgaa atgtgcccgc tttttggaag aaagtgccca tcggtgcaac cactgcagaa      3120
     acgtagactt cattccctac caccatttca tagtggacat tcgactcaac actttggata      3180
     tggacactgt caagaggatg gtgacatccc aaggatttaa aattgacgaa gaggaagccg      3240
     tcttttctaa gtcagagctc cctaggaaat acaagttccc cgagaatctc agcatcacag      3300
     aaataaggga aaaaatcttg catttctttg acaatgtcat cctaaagatg aaatcgtctc      3360
     caaatgacat catccctctg gaatcctgcc agtgtaagga actgctccag attgtcatcc      3420
     tgcctctggc ccaacatttc gtagccttag aagaaaacaa caaagccttg tactacttcc      3480
     tagaactggc atctgcctac ctcatcctgg gagacaacta taatgcgtac atgtatttgg      3540
     gcgagggaga aaggctgctg aaatctctga cgaatgaaga ttcttggagt cagacctttg      3600
     aatatgctac cttttatagt ctcaaggctg aggtctgttt taacatgggg cagatggtcc      3660
     tcgccaagaa gatgctgagg aaggcgctga agctgctcaa cagaatgttt ccctgcaatc      3720
     tgctcaccct gactttccaa atgcatgtgg agaaaaacag actctcccac ttcatgaacc      3780
     agcataccca ggagggctcg gtgccaggga agaaactggc acaactttac ctgcaagctt      3840
     cctgcttctc cttgctgtgg aggatctaca gcttgaactt ctttttccac tacaagtatt      3900
     acggtcatct ggccgcgatg atggaaatga acacttccct ggaaactcaa aatgacttcc      3960
     agatcatcaa ggcttacctg gacttttccc tgtaccacca cctcgctggc taccagggcg      4020
     tgtggttcaa atatgaaata ctggtcatgg agcagctcct gaacctcccc ctgaaaggcg      4080
     aggccattga gatcatggcg tatacagccg acacactggg ccacatcaag ttcttaatgg      4140
     gtcatctgga cttggccatt gagttaggct ctcgagccca caggatgtgg tcacttcttc      4200
     ggaatcccaa caaataccag atggttctct gcagactgag taaacctctt ttcttgaaaa      4260
     gcagatataa acatttggtc caggtgctgg gatggttgtg ggacctttct gtaacagaag      4320
     aggacatctt cagcaaggca tttttctatt tcgtctgctt ggacatcatg ctttattctg      4380
     gcttcattta cagaacattt gaagaatgct tggaattcat acaccacaat gaagacaaca      4440
     gaatcctcaa gttccagagc ggactcctcc tgggacttta ctcctgcatc gctgtctggt      4500
     atgccagact tcaagagtgg gacaacttta acaaattttc cgacagagct aagcatctcg      4560
     tgacacgaag aaccccgaca gttctttact acgaagggat ctctaggtac atggaagggc      4620
     aagtcctcca cttgcagaag caaatagaag aacaggccga gaacgctcag gacagtgggg      4680
     tggagatact caaggccttg gagacccttg tggctcaaaa taccaccggc cccgtcttct      4740
     acccgaggct ctaccatctg atggcctatg tctgcatact aatgggagac gggcacagct      4800
     gtgacttctt cctgaacaca gccttggagc tttctgagac acatgggaat ttgctggaga      4860
     aatgttggct aagcatgagc aaggaatggt ggtactcagc ctccgagtta acaggagatc      4920
     aatggcttca gacagtcttg agtcttccat catgggataa aattgtatca ggcaagggag      4980
     gtcagaggaa acgttcgtgg agttggttct gtccccccaa cttttcaatg gtttcctgga      5040
     gtcaacctca gtgtgcatga cggcttggag ctgcacagga ttgcaaatgt caagcctctg      5100
     tcgaggtctg aagcagcaag attagaaaga ataaagttgt ctgtgccagc ttccggagcc      5160
     atggtggtgc cccacaggca cctcacatct gtacaaataa aagctttaag t               5211
//


spacer
spacer