spacer

EBI Dbfetch

ID   AK029526; SV 1; linear; mRNA; HTC; MUS; 1475 BP.
XX
AC   AK029526;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4921513M21 product:lectin, galactose binding, soluble 8, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1475
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0eb36cf0da1b1169e5a037a5fda95a20.
DR   Ensembl-Gn; ENSMUSG00000057554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099820; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4921513M21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1475
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4921513M21"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             462..1412
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="lectin, galactose binding, soluble 8
FT                   (MGD|MGI:1928481 GB|NM_018886, evidence: BLASTN, 100%,
FT                   match=1086)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9JL15"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR030638"
FT                   /db_xref="MGI:MGI:1928481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JL15"
FT                   /protein_id="BAC26495.1"
FT                   /translation="MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERF
FT                   QVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEI
FT                   VFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSA
FT                   LGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKT
FT                   RDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVAI
FT                   NGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW"
XX
SQ   Sequence 1475 BP; 424 A; 359 C; 373 G; 319 T; 0 other;
     gagcccaaac attaagacgt gggacatgaa acctgtagaa cataagaggg ctggaactac        60
     aggggtgcac cccgaccgat ttgggcagag ctgggtggaa atcaacctgg gggcttccag       120
     cacgtgaggt gagccacacc ccaaccccag ccagccactc ccacagccag ccataggtct       180
     gcgtgtgtga cattaagagc ccaacagccc cagctcgcag cactcggacg ccccgcccct       240
     gcagtcgttc tcgcggaaac ggccgcgggc tgaccccgcc ctctgcctgt ggcggctccg       300
     ggaaccggac ggcgtccgtc aggggacaca agtcggagca aagcgcttac taccaccggg       360
     gacaagtttt tactttgagt aatccttaaa tgaagagtgg gtaaagtgtg tatacggaag       420
     agagactcca atcaacaata tcaataagtt gaaaaagaaa aatgttgtcc ttaaataacc       480
     tacaaaatat catctataac ccgataatcc cctatgttgg caccattact gagcaattga       540
     agcctggctc tctgattgta atccgtgggc atgtccctaa agattcagaa agattccagg       600
     ttgactttca gctgggcaac agcctgaagc caagagcaga cgtggccttc cactttaacc       660
     ctcggttcaa aaggtctagc tgcattgttt gtaacacact gacacaggag aagtggggct       720
     gggaggagat cacctacgac atgcccttca gaaaagaaaa gtcctttgag atcgtgttca       780
     tggtgctcaa gaacaaattc caggtggctg tgaacggaag gcatgttctg ctgtacgccc       840
     acaggatcag cccggagcag atcgacacag tgggcatcta cggcaaagtg aacatccact       900
     ccatcgggtt cagattcagc tcggatttac agagtatgga aacatctgct ctgggactga       960
     cacagataaa cagagagaat atacaaaagc caggcaagct ccagctgagc ctgccatttg      1020
     aagcaaggtt gaatgcctcc atgggtcctg gacgaaccgt tgtcattaaa ggggaagtga      1080
     acaccaatgc ccgaagcttt aatgttgacc tagtggcagg aaaaacaagg gatatcgctc      1140
     tgcacttgaa cccacgcctc aatgtgaaag catttgtaag aaattccttt cttcaggatg      1200
     cctggggaga agaggagaga aatattacct gcttcccatt tagttctggg atgtactttg      1260
     agatgataat ctactgtgat gtccgggaat tcaaggttgc tataaatggt gtgcacagcc      1320
     tggagtacaa acacagattt aaagacctaa gcagtattga tacactatca gtcgatggtg      1380
     atatccgttt gctggatgta aggagctggt agctaccatg actgccaaaa cccccgaaat      1440
     acaaaatggc ttatccggta ctggccatgt caaat                                 1475
//


spacer
spacer