Dbfetch

ID   AK029071; SV 1; linear; mRNA; HTC; MUS; 4546 BP.
XX
AC   AK029071;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:4732488K06 product:sortilin-related receptor, LDLR class A
DE   repeats-containing, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4546
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 23decb3e58a792abf3a6ca357f5be204.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4732488K06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4546
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4732488K06"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..663
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="sortilin-related receptor, LDLR class A
FT                   repeats-containing (MGD|MGI:1202296 GB|AF031816, evidence:
FT                   BLASTN, 99%, match=1472)"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q8CE39"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CE39"
FT                   /protein_id="BAC26276.1"
FT                   /translation="KLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHV
FT                   LLFWKSLALKEKQFNETRGYEIHMSDSAVNLTAYLGNTTDNFFKVSNLKMGHNYTFTVQ
FT                   ARCLFGSQICGEPAVLLYDELSSGADAAVIQAARSTDVAAVVVPILFLILLSLGVGFAI
FT                   LYTKHRRLQSSFSAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA"
FT   regulatory      4528..4533
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      4546
FT                   /note="putative"
XX
SQ   Sequence 4546 BP; 1156 A; 1007 C; 1034 G; 1349 T; 0 other;
     aagctggaac ctggagggaa ataccacatc attgtccagc tgggaaacat gagcaaggat        60
     tccagcataa aaatcaccac agtttcgtta tcagcacctg atgccttaaa aatcataacg       120
     gaaaacgacc acgttctcct cttttggaaa agcctagcac tgaaggaaaa gcagttcaat       180
     gaaaccaggg gctatgagat ccacatgtct gacagcgctg tgaatctcac cgcttacctc       240
     gggaatacta cggacaattt ctttaaagtg tccaacctga agatgggtca taactacact       300
     ttcacggtcc aagcgcggtg tctctttggt agccagatct gtggggagcc cgccgtgctg       360
     ctgtacgatg aactgagctc aggtgcagat gcggcagtga tccaggctgc ccggtctact       420
     gatgttgcag ctgtggtggt tcccatcctg ttcctgatcc tgctgagcct gggtgtcggc       480
     ttcgccatcc tctacacgaa gcaccgtcgc ttacaaagca gcttcagcgc tttcgccaac       540
     agccactaca gctccaggct gggctcggcc atcttctcct caggggatga cctaggagag       600
     gacgatgaag atgctcccat gattactgga ttctcagacg atgtccccat ggtgatagcg       660
     tgaagagctt ttctcattag aaaccaaatg gtgtaaatat tttatttgat aaagatagtt       720
     gatggtttat tttaaaagat gcactttgag ttgcaatatg ttatttttat atgggccaaa       780
     actacaaaaa aaaaaaagag gaaaagaagg aatgaataaa ctttgtagta tcaactgtga       840
     actgaaacca ggttgatttt agtaaccaca ttctttgatt tgacattgat gtcatcttac       900
     agggctgcgc ttgctgggca tgcttttaag tctgtgagat cattttgctt cattaagttg       960
     accattcttt ttgtttttct aagacacaga aatgtattta ataaaacctt caagagagag      1020
     taatggacgg agtgcattct ccttgaaaac tgttcagagt ttacgtctcg tttgggttca      1080
     gtttacataa gtgtgtgggt gtcttgtggg ggaaggttct gtgctcttgt ttttgttaat      1140
     ttattggaac tctgtataag gccatatttt agtggctgtc tgaaacccca tgtgtgaagg      1200
     gccccttgcc caacagggtt gaggtgggga gcaagagcaa tctgttttta tttgctcgta      1260
     tgtcagggac aggtgtttgg cagaagagac ttctaggtta ctgctagatt ccaattcaac      1320
     tgccttgtag cctgggaagc ccagcaagtc ataacctcct gtcttctagg aacccgtggg      1380
     cttttactgt gcatgtctct gtacaaagtg tacctctgga agctgccaag tgataacact      1440
     gctttcttat acactgggat cattgtcact tgaaaaaaaa aacattattg tggttgtggg      1500
     agaaagctct agatctgtgc cataatagat atgcattgca attgtatgcc atgtctccat      1560
     tttaaatttg agtttccctt tcgtttttac tcaccaccaa agaatctcaa atgtaaaatt      1620
     ttatattggg tttgaaccac tgacgtgtcc attctgatat atgcagtcat tttgaatttg      1680
     gtctgtgcct tctctggatc cctccctagc ctgtgccccg agccgtccat agagagtttg      1740
     taggtatttc cagggatgga gaagatctaa gcatttgact tccccatcag tacatttgtt      1800
     catttgcttt ctctgtgaaa cgccatgatt gtctaaacaa gtctcccctc tgccctgatc      1860
     cctttgtacc aagtcaatgg ccacttgaaa gttctgtgga ctcccttgtg gcctcaaccc      1920
     gttcgtcctt cagcctgtca tccttcaggc accgacgccc aacctgccgt gacctgtgct      1980
     gtatgaacaa cctcactgag gatttcctcc cggcagaaaa gcagcaagct ctgcaaatat      2040
     cccaaagtta tgcctctgaa cacatgtctt ctatatgcaa gttttgtgaa acctgcctcc      2100
     ttcccgtgca atgtgtccct cctcacaagt gcttagtttc tgttaactag aagtatcatt      2160
     cttgggtggg aataggtctc cgtttacctg agctgagggt tgtttggaaa ataagagcca      2220
     atttttctta gaatatatat gtatattaaa tgagcatttg acctgtagat acatagtgtg      2280
     ccgtttggcc agagctcctg gtgtcaaatg ctgggaacag gagtcttctt acaaattatt      2340
     tttctcctct ttcctctcgc cctctctttc actattttcc ccccagactg gaatttcctc      2400
     agctttatct tgtcttgctt tgaagttttg ctcaatgttc ctcccttccg accacttcca      2460
     cttaaataaa gtctttaagt agctgaagga ttaacagtct ggtgggaggc aagccattga      2520
     actgaaccac gaggaaagta tattttcttc ttttcttttc ctgccaagtt ttcggtggca      2580
     tttgtagaag ctggtgtgaa aggctaggag gcattgtttt ctattattcc tcggtgaagc      2640
     cttttcccag agcatatgtc tccggcaggc agtgtgggtt cttgccaagc atcagaacca      2700
     gtctccaggg cctcccgacg ccgatccata gtactgtaca gacccaccgc cacccttctc      2760
     ctcggaagat gcactgtgct gtttgaaaac atgtagccgt ttaaggctag agtattttat      2820
     ataaatagaa gagcttaggt cctgaagacc aaggcagata gatgcagcta tgtgtacatt      2880
     gtatattttt gtgaacttct caagcacgca ctcccgtttc cctctgcttt gcagaggttt      2940
     tgatgtatcc ctgccgtctg caagagtcca gaggctggac tgacagtagg aagtagaaat      3000
     aagctatgtg tagtcttgga aagttcccac ctcacaggga atgaaaccta gggaacacca      3060
     ggtactcggc gccctgtgga ctgtgtggaa actgattttt cttttttcta tactgaatac      3120
     cctttgagat ttgtgtggga catgggtcca tgtgggttta gtgacagaga agagttcctc      3180
     caaggactct tggagagggg ccacatctga ggagacaggt gagaagtctc catcactgct      3240
     tggtgcctgg caagctggag aggtcagcct gctgccaggc aactggctgt ctttgggagg      3300
     ggtggctctt aagactctac ctctgattgc atcactagga ctaactacaa gctggctggg      3360
     gatactccct tgtgtgttct gtcctatcca gatggcctgc tagattgaat tatactcacc      3420
     aacacataga acaggccctt tagaaggcac taggtgtttg gaggtgagct aggaagacca      3480
     gtggtatgtt gagcccctta cagataagca ccggtgtctc tttggtgcac cttgccttca      3540
     gatgctcctg gtggtcagct caactagcaa gaccctagtc ccctgttcca aagccatctc      3600
     atatgttagt tctctgtccc atgaagaggg ccgtggtgag ttcccgagaa ttgtctctct      3660
     ttcagcagag aggtgaggga ctcagacata tatctaagtt gaatagcatc cccatcgcag      3720
     ctgtaagaat tgagctgcag aaggtaccct ctgtcgggat tgtatctcga catccctgtc      3780
     gcgtttttct tagctggagt gtgtgctgcc tttcaggtac aacttttatg taataaaagc      3840
     cagagcatta agcttacaca gactactttc tatgcaagac agagatatgg actaggttac      3900
     aggaaacgtg caccgttggc tccacagaca agaagtgcat tgccagaaga gcatcactga      3960
     acggagcgga gggaggacca gttgcatgtg tttctgccca ctcattttga gcagccatat      4020
     tataaaatgg atcatcagag ctgagtgaca acacgagagt ggtactggtt tcatgtgcga      4080
     ggacttccat ggactgaaca tggatgccgg agcagagcat caattccttc atagattcca      4140
     agtcactcct cgatgaagac tcttgttgag acttactaaa cactttaggc gcagtcggga      4200
     ggatctgcag caaaataaag gcctgttctg ctcttattta acatgaagca ctgtgtactt      4260
     gtttcttctc tccaaagtaa aattagatta tttataactt cgatcgcctc ggctaggttt      4320
     ccaagtcact gatttctgct gaagatttta ctacgttgtt gcacaatttt aagataattt      4380
     tttttttttt ggtcttggtg tcaacctttt tcactgaata aaaatttaac tgggttaaaa      4440
     aagaaaaaca atgaaaaaaa ataaagacaa cgccatcacc tatttaaata tccactgtgt      4500
     gtgtcacaaa gttgttcttt tgagtgcaat aaagatagct taacgc                     4546
//