spacer

EBI Dbfetch

ID   AK028946; SV 1; linear; mRNA; HTC; MUS; 3280 BP.
XX
AC   AK028946;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 15)
XX
DE   Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:4732473G18 product:GAMMA-AMINOBUTYRIC-ACID RECEPTOR PI SUBUNIT
DE   PRECURSOR (GABA(A) RECEPTOR) homolog [Rattus norvegicus], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3280
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5c2c1ac02c089c3b3e4770e4bc05359e.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4732473G18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3280
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4732473G18"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS             199..1521
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="GAMMA-AMINOBUTYRIC-ACID RECEPTOR PI SUBUNIT
FT                   PRECURSOR (GABA(A) RECEPTOR) homolog [Rattus norvegicus]
FT                   (SWISSPROT|O09028, evidence: FASTY, 98.4%ID, 100%length,
FT                   match=1320)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW7"
FT                   /protein_id="BAC26209.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   polyA_signal    3267..3272
FT                   /note="putative"
FT   polyA_site      3280
FT                   /note="putative"
XX
SQ   Sequence 3280 BP; 868 A; 781 C; 687 G; 944 T; 0 other;
     gagagagcgc gccactccat cggagactgg gtgcatactt aacacccaaa gagtcaggac        60
     tgagatgaaa aggaccctgg agacccaaaa gagtatgctc tgtgtgagag tcctgcctga       120
     gatctggaaa cacctgctgt aacagctgcc tggtgattcc tccttcaacc tttttgtgtg       180
     tgaatcagct ccttcaacat gagctacagc ctctatttgg ccttcctgtg tctgagtctc       240
     ctcactcaga ggacgtgcat ccaggggaac caggtcaatg tggaggtcag cagaagtgac       300
     aagctttcct tacctggctt tgagaacctc actgcaggat ataacaaatt cctcaggccc       360
     aatttcggtg gtgacccagt tcggatagca ctgactctgg acatcgccag catctctagc       420
     atctcagaga gtaacatgga ctacacagcc actatatacc tccggcagcg ttggacagac       480
     ccacggctag tgttcgaagg caacaagagc tttactctag atgcccgcct tgtggagttc       540
     ctctgggtgc cagacactta cattgtagag tccaagaagt ccttcctcca tgaagtcaca       600
     gtgggaaaca ggctcatccg cctcttctcc aacggcacag tcctgtacgc acttagaatc       660
     acaacaacag ttacatgtaa catggatctg tctaaatacc ccatggacac acagacctgc       720
     aagctgcagc tagaaagttg gggatacgat ggcaatgatg tggagttctc ctggctgaga       780
     gggaatgact cggtgcgtgg acttgaaaac ctgcgccttg ctcagtacac aatccaacag       840
     tatttcaccc tggtcaccgt atcccagcag gagacaggaa actatacgag attggttttg       900
     caatttgagc ttcggaggaa cgtcctgtat ttcattctgg aaacctatgt cccttccacc       960
     ttcctggtgg tgttatcctg ggtctccttt tggatctccc tcgattcagt tcctgcgaga      1020
     acctgcattg gagtgacaac ggtgttatcc atgacaacgc tgatgatcgg ctcccgcaca      1080
     tccctaccca acaccaactg cttcataaag gccatcgatg tgtacctagg catctgcttc      1140
     agcttcgtgt ttggggcctt actggagtat gcagttgctc actacagctc cttacagcag      1200
     atggcagtca aagatagggg gccagcgaag gactcggaag aagtcaatat caccaacatc      1260
     atcaacagct ccatctccag ctttaaacgg aagattagct ttgccagcat tgaaatctct      1320
     ggtgacaatg tcaactatag tgacttgaca atgaaagcca gcgacaagtt taagtttgtc      1380
     ttccgcgaga agatcagcag aatcattgat tatttcacaa ttcaaaaccc cagcaatgtg      1440
     gatcgatact ccaaactact atttcctttg atttttatgt tggccaatgt attttactgg      1500
     gcatactaca tgtatttttg agacgccatt gaactcttgc atcacataat gaggttaagg      1560
     gtattctaga acatgtgtgt gcacttcagc ttagaaagct acaaatgggc taatgtaaca      1620
     attattctaa gttgtgtaga agccctagtg tgaccagatt ctataataga gtcattataa      1680
     ggcaaccctt ttcttcttca attttggaca gaacaccccc tccacacaca tacacagaac      1740
     ccaagactgc gaacctactc agggctattt gctctctgga tccctggtct gcattcactc      1800
     cataaaaatg tgggaagatg attacatata ttaaggggtt tattttctaa agaattcata      1860
     gtgccactga ttacatctct gtggccctta taatatgctc tcttgcctat ttaaacacca      1920
     gtgttttcta atttttgttt ttccttgaaa tatgaaatgt gggtttgcgt caattcattg      1980
     gtggttacct tgcctcatca acctaatacc agatgggttc ttagtgttat ttaataccac      2040
     agaagaattg tccccaaatt ctaatacatc ctattattca caaatcagat gtaaatgaat      2100
     aaaattagtg gatcaataaa ctaaaagaaa aaaacataaa tcctttgggg tccagggctt      2160
     catgccgttt ttccacgtat cttattattt tgtttttata caccttagtc ctaacctatg      2220
     taaaaacccc ttttccacat caggaaaacg ggaggaagtt ttgaaacttg ttctggattc      2280
     ctaatacaga atgcgtccat gaagacttcc tgagtcaagt gtactagcta gccaccttta      2340
     ctcacatact ggctaggaac caagtagacc agagagtgct ctgtcaacct gtcctctctg      2400
     ctgacctgtt gaccaagatg ctggggaaca ttttgccggt ggcaaaggcc ctgcctcctt      2460
     caaagaggag cttttatccc tgtgctccag tgactaggca ggagtgatgt ctattagata      2520
     agaagcggca ctactgggac acaagtagct tatcttaaat agttaccttt tcccaacctt      2580
     tctagctgga ctactttgag tggattaccc tgcctgagca gcagaccact ggccctgact      2640
     ggttccgact gttctgaacg atggaaagac acattgcaca acccacgtga gctgtctttt      2700
     ctgagttcag ccagggtcac cctgacctag gagctcttgt gtgccctctc tctctcttgc      2760
     tccacgggaa tcgcctatat aaggttccaa tgcagcctca attgtttcaa agactcttgc      2820
     tgtcttcagg tctttccctt ccttttctaa tgaaccctca gctttccctg tcctttctac      2880
     aacaaaccgg ggctgtagat gttctttcct ttcacgtcct tcacccacgg gccctccttt      2940
     tcatcagcat ggctctgccc atcgttccgt ttctgtgagc ttgagtgcct ggcgcttaac      3000
     agatgtttct attttaggat tcgctttgtt cattggagta caataggtgt agttgcgcca      3060
     ttagagttct tagtagaatc tctttgtatt ttgtatctgt catatacatt cctaagggga      3120
     ggggctaggg gaggggaagt gtggttgagt gagtaggtca tacctgtgca ttttttttta      3180
     aaaataaaaa tgtttaaaat ataacttcac tgaggcctca ttttaagcta cagaaaaata      3240
     aaagttgtaa atatgtgaaa ctataaaata aatatatagt                            3280
//


spacer
spacer