spacer

EBI Dbfetch

ID   AK028704; SV 1; linear; mRNA; HTC; MUS; 3923 BP.
XX
AC   AK028704;
XX
DT   18-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 10 days neonate skin cDNA, RIKEN full-length enriched library,
DE   clone:4732440A06 product:similar to CALCIUM-ACTIVATED CHLORIDE CHANNEL-2
DE   [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3923
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 818cc09c5e87175191a0307d20cbd4fb.
DR   Ensembl-Gn; ENSMUSG00000036960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040465; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4732440A06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3923
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4732440A06"
FT                   /tissue_type="skin"
FT                   /db_xref="taxon:10090"
FT   CDS             79..2907
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="similar to CALCIUM-ACTIVATED CHLORIDE CHANNEL-2
FT                   [Homo sapiens] (SPTR|Q9Y6N2, evidence: FASTY, 72.1%ID,
FT                   100%length, match=2826)"
FT                   /db_xref="GOA:Q8BG22"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004727"
FT                   /db_xref="InterPro:IPR013642"
FT                   /db_xref="InterPro:IPR015394"
FT                   /db_xref="MGI:MGI:2139758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG22"
FT                   /protein_id="BAC26076.1"
FT                   /translation="MTHRDSTGPVIGLKLVTLLFTLSPELLFLGAGLKLKENGYDGLLV
FT                   AINPRVPEDLKLITNIKEMITEASFYLFNATKRRVFFRNVQILVPATWTDHNYSRVRQE
FT                   SYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELAAGYGARGRVFV
FT                   HEWAHLRWGVFDEYNNDKPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKIF
FT                   REGCTFLYNSTQNATGSIMFMPSLPSVVEFCNESTHNQEAPNLQNQVCSLRSTWDVITA
FT                   SSDLNHSLPVHGVGLPAPPTFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELYLM
FT                   QVVEAHTFVGIVTFDSKGEIRASLQQIYSDDDRKLLVSYLPTAVSTDAETNICAGVKKG
FT                   FEVVEERNGRADGSVLILVTSGADEHIANCLLTSMNSGSTIHSMALGSSAARKVGELSR
FT                   LTGGLKFFIPDKFTSNGMTEAFVRISSGTGDIFQQSLQVESVCETVQPQHQLADTMTVD
FT                   SAVGNDTLFLVTWQTGGPPEIALLDPSGRKYNTGDFIINLAFRTASLKIPGTAKHGHWT
FT                   YTLNNTHHSPQALKVTVASRASSLAMSPATLEAFVERDSTYFPQPVIIYANVRKGLHPI
FT                   LNATVVATVEPEAGDPVVLQLLDGGAGADVIRNDGIYSRYFSSFAVSGSYSLTVHVRHS
FT                   PSTSTLALPVPGNHAMYVPGYITNDNIQMNAPKNLGHRPVKERWGFSRVSSGGSFSVLG
FT                   VPDGPHPDMFPPCKITDLEAMKVEDDVVLSWTAPGEDFDQGQTTSYEIRMSRSLWNIRD
FT                   DFDNAILVNSSELVPQHAGTRETFTFSPKLVTHELDHELAEDAQEPYIVYVALRAMDRS
FT                   SLRSAVSNIALVSMSLPPNSSPVVSRDDLILKGVLTTVGLIAILCLIMVVAHCIFNRKK
FT                   RPSRKENETKFL"
FT   polyA_signal    3904..3909
FT                   /note="putative"
FT   polyA_site      3923
FT                   /note="putative"
XX
SQ   Sequence 3923 BP; 1126 A; 891 C; 908 G; 998 T; 0 other;
     gagctgcttc cacattgatc agctgactca aggtacccag caggctcccc gtgaataaac        60
     cagaggtttc actgcaagat gacccacagg gacagcacag gacctgtcat cgggctgaaa       120
     cttgtgaccc ttctgttcac cctaagtcca gaacttctgt tcctgggagc tggattgaag       180
     ctgaaagaga atggctatga tggattgctt gttgccatca atccccgggt acccgaggat       240
     ctgaagctga ttacaaacat taaggaaatg ataaccgaag cttcctttta cctgttcaat       300
     gcgaccaaga ggagggtgtt tttcagaaat gtacagattt tagtacctgc cacttggacg       360
     gatcataatt acagtagagt aagacaagaa tcctatgaca aggcaaatgt catagtggct       420
     gagcagagtg aggaacacgg agatgatccc tacaccctac agcacagagg gtgtgggcaa       480
     gaggggagat acatccactt cacccccagc ttcctactca acgatgagtt agccgcaggc       540
     tatggtgcgc gaggcagagt gtttgtccac gagtgggccc atctccgctg gggtgtgttc       600
     gatgaatata acaacgacaa accgttctac gtgaatggac ggaatgagat tcaagtcacc       660
     aggtgttcat ctgacattac aggcgttttt gtgtgtgaaa agggcctctg cccccatgaa       720
     gactgcatta ttagcaagat ttttagggaa ggatgcacat tcctctacaa cagcacccag       780
     aatgcaactg gatcaataat gttcatgcca agtttacctt ctgtggttga attctgtaac       840
     gaaagtacac acaaccaaga agctccaaac ctccagaacc aagtgtgcag cctcagaagc       900
     acttgggacg tgatcacagc ctcctccgac ctgaaccata gcctccccgt gcatggggtt       960
     ggacttccag cccctcccac gttctccctc ttgcaggctg gtgaccgagt ggtctgctta      1020
     gtgattgatg tgtccaggaa gatggcagag ggagacagac tgctccgact tcaacaagca      1080
     gccgaactgt acttgatgca ggttgtcgaa gctcacactt tcgtgggcat tgtcactttt      1140
     gatagcaaag gagaaatccg agcctcgctg cagcaaattt acagtgacga tgaccggaag      1200
     ctgctggttt catacctgcc gaccgccgtg tccactgacg cagaaacgaa catctgtgca      1260
     ggggttaaga aaggctttga ggtggttgag gagcggaatg gaagagctga cggctctgtc      1320
     ctgatattag tgaccagtgg agcagatgaa cacattgcca actgcctgct cacctcgatg      1380
     aacagtggat ccaccattca ctccatggcc ctgggttcct ctgcagccag aaaagtgggg      1440
     gaattatcac gtcttacagg aggtctaaag ttcttcattc cagataaatt tacttctaat      1500
     ggaatgactg aagctttcgt tcgaatctct tctggaacag gagacatttt ccagcaaagc      1560
     ttacaggttg agagcgtgtg cgaaactgtg caaccccagc accagctggc ggatactatg      1620
     actgtggata gcgccgtggg caatgacaca ctttttctag tcacgtggca gactggtggc      1680
     ccccctgaga ttgcattatt ggatcctagc ggaagaaaat acaacactgg tgactttatc      1740
     atcaacctgg cctttcggac agccagcctt aagattccag ggacagctaa gcatgggcac      1800
     tggacttaca cgctgaacaa cacccaccat tctccccaag ctctgaaagt gacagtggcc      1860
     tctcgtgcct ccagcctggc catgtcccca gccactctgg aagcctttgt ggaaagagac      1920
     agcacctatt ttcctcagcc agtgatcatt tatgcgaatg tgaggaaagg tctgcatccc      1980
     attctcaatg ccaccgtggt ggcgacagtg gaaccagagg ctggagatcc cgttgtactg      2040
     caacttttgg atggcggagc aggtgcagat gttataagaa atgatgggat ttactccagg      2100
     tatttttcct cctttgctgt aagtggtagc tatagcctga cagtgcatgt ccgtcactct      2160
     cccagcacaa gcacactagc cctccctgtc ccaggaaacc atgctatgta tgtaccaggt      2220
     tacataacaa acgataatat tcaaatgaat gctcccaaaa acttgggcca cagacctgtg      2280
     aaggagaggt ggggcttcag tcgagtgagc tcgggaggct ccttctccgt gctgggagtc      2340
     ccagacggcc cccaccctga catgtttcca ccgtgcaaaa ttactgacct ggaagccatg      2400
     aaagtggaag acgacgtcgt cctctcttgg acggcacctg gggaagactt cgatcagggg      2460
     caaactacaa gctatgaaat aagaatgagc agaagcctat ggaacattcg ggatgacttt      2520
     gacaatgcca tcttggtgaa ttcgtcagag ctagttcctc agcatgctgg caccagggag      2580
     acatttacat tctcacccaa gcttgtcacc catgaacttg atcatgaact tgctgaagat      2640
     gcacaagaac cctacatagt gtatgtggcc ctgagagcca tggatagaag ctccctcagg      2700
     tcagctgtgt caaacattgc cctggtatca atgtctcttc ctccaaactc ttctcctgta      2760
     gtgagcagag atgatctgat cctgaaagga gttttaacaa cagtaggttt gatagcaatc      2820
     ctttgcctta ttatggttgt agcacactgt atttttaaca ggaaaaagag accatcaaga      2880
     aaagagaatg agacaaaatt tctatgaaca agcaggcaca gtatcttcct tcttaggtag      2940
     gatggacatg acctttacat ccacaaaata aaatgtgaac aaaatcaaaa tagtctcgac      3000
     atggggactt ttacataatg caaaaatgcc ctcccccccc ccccaaaaaa aacccaccaa      3060
     cttttaactc attttgggaa agggttagaa aacagtgtaa ggttccagtt atggaaaaat      3120
     aataaaatat attgctcaag gtaatggctt gaaaggcaaa ggaagaacaa aatcaaatcg      3180
     agtcaagaaa agcttgtttt attgaagttc aggttggggg aagttctggg tacagaaaag      3240
     aatgttgggt cttagttaga cagtgtaact atctgtatga tgcaaacatg ttactttgat      3300
     gaatttctca tctctgctta tctgtgcaga gaaggacaca tgtttatact gacaaccaag      3360
     ctgctttata gaagaggcca tactacaggg ttctttatat cttgtccttt ggttaaattc      3420
     actgtggctc acaagacacc actaaagttc agataggact tttctcacca tgagaggaga      3480
     ccttagaatg caattgttgt ccttgtccct tggatactga tctgtagcag aggtcaccgg      3540
     agtttactgt ttgtaagacg ttagtgccat tgaagcagct ttctaagtta ttggcttgga      3600
     agtattgaat gaaaatggtt acggctccca tgaggcttta caggtaaaag acattatgct      3660
     gaaataattt taatatatac accatatagt tttattccat ctcaaataag aagtcatgga      3720
     aacaattagc aaattctgcc ccggtttaat aagtacatgc aattcttttc ttcatcaagg      3780
     acacagagaa gacagcagag aaaatgtgga aataaaaatc atctaatgct acttcttcct      3840
     tttaaaaaat gttatttaat aatattatgt catttctaaa ttcaagaact taaaggttta      3900
     ttgaataaat attatgttac agt                                              3923
//


spacer
spacer