spacer

EBI Dbfetch

ID   AK028370; SV 1; linear; mRNA; HTC; MUS; 775 BP.
XX
AC   AK028370;
XX
DT   21-DEC-2002 (Rel. 74, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 14)
XX
DE   Mus musculus 18 days pregnant adult female placenta and extra embryonic
DE   tissue cDNA, RIKEN full-length enriched library, clone:3830425O06
DE   product:nucleophosmin 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-775
RA   Adachi J., Aizawa K., Akimura T., Arakawa T., Bono H., Carninci P.,
RA   Fukuda S., Furuno M., Hanagaki T., Hara A., Hashizume W., Hayashida K.,
RA   Hayatsu N., Hiramoto K., Hiraoka T., Hirozane T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Kagawa I., Kasukawa T., Katoh H., Kawai J., Kojima Y.,
RA   Kondo S., Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T.,
RA   Miyazaki A., Murata M., Nakamura M., Nishi K., Nomura K., Numazaki R.,
RA   Ohno M., Ohsato N., Okazaki Y., Saito R., Saitoh H., Sakai C., Sakai K.,
RA   Sakazume N., Sano H., Sasaki D., Shibata K., Shinagawa A., Shiraki T.,
RA   Sogabe Y., Tagami M., Tagawa A., Takahashi F., Takaku-Akahira S.,
RA   Takeda Y., Tanaka T., Tomaru A., Toya T., Yasunishi A., Muramatsu M.,
RA   Hayashizaki Y.;
RT   ;
RL   Submitted (16-JUL-2001) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3219493e002f2c85721e927a08b2bb89.
DR   Ensembl-Gn; ENSMUSG00000057113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109354; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3830425O06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..775
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="18 days pregnant adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3830425O06"
FT                   /tissue_type="placenta and extra embryonic tissue"
FT                   /db_xref="taxon:10090"
FT   CDS             98..>775
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nucleophosmin 1 (MGD|MGI:106184 GB|NM_008722,
FT                   evidence: BLASTN, 100%, match=755)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BSZ3"
FT                   /db_xref="InterPro:IPR004301"
FT                   /db_xref="InterPro:IPR024057"
FT                   /db_xref="MGI:MGI:106184"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BSZ3"
FT                   /protein_id="BAC25910.1"
FT                   /translation="MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLR
FT                   TVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKC
FT                   GSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDE
FT                   DDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKG
FT                   QESF"
XX
SQ   Sequence 775 BP; 250 A; 148 C; 203 G; 174 T; 0 other;
     gtccttgcgt gattccgcct gcgcgtctgt tctgtggaac aggaggcagt tgttttccgt        60
     ccggcttctc ccacaccgaa gtgcgcgcct ccacctcatg gaagactcga tggatatgga       120
     catgagtcct cttaggcctc agaactacct tttcggctgt gaactaaagg ctgacaaaga       180
     ctatcacttt aaagtggata atgatgaaaa tgagcaccag ttgtcattaa gaacggtcag       240
     tttaggagca ggggcaaaag atgagttaca catcgtagag gcagaagcaa tgaactatga       300
     aggcagtcca attaaagtaa cactggcaac tttgaaaatg tctgtacaac caacagtttc       360
     cctagggggc tttgaaatta caccacctgt ggtcttacgg ttgaagtgtg gttcagggcc       420
     tgtgcacatt agtggacagc atctagtagc tgtagaggaa gatgcagagt ctgaagatga       480
     agatgaggag gacgtaaaac tcttaggcat gtctggaaag cgatctgctc ctggaggtgg       540
     taacaaggtt ccacagaaaa aagtaaaact tgatgaagat gatgaggacg atgatgagga       600
     cgatgaggat gatgaggatg atgatgatga tgattttgat gaagaggaaa ctgaagaaaa       660
     ggtcccagtg aagaaatctg tacgagatac cccagccaaa aatgcacaaa aatcaaacca       720
     aaatggaaaa gacttaaaac catcaacacc gagatcaaag ggtcaagagt ccttc            775
//


spacer
spacer