spacer

EBI Dbfetch

ID   AK024482; SV 1; linear; mRNA; STD; HUM; 4460 BP.
XX
AC   AK024482;
XX
DT   29-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for FLJ00076 protein, partial cds.
XX
KW   fis (full insert sequence); FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4460
RA   Ohara O., Nagase T., Kikuno R., Okumura K.;
RT   ;
RL   Submitted (24-AUG-2000) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Department of Human Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:cdnainfo@kazusa.or.jp, URL:http://www.kazusa.or.jp/NEDO,
RL   Tel:81-438-52-3913, Fax:81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
DR   MD5; 2d5e3e8071900893269c6c32ae7f64a7.
DR   Ensembl-Gn; ENSG00000106009; homo_sapiens.
DR   Ensembl-Tr; ENST00000340611; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing and clone
CC   selection: Kazusa DNA Research Institute.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4460
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone="as00076"
FT                   /tissue_type="spleen"
FT                   /note="vector:pBluescriptII SK plus"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..897
FT                   /codon_start=1
FT                   /gene="FLJ00076"
FT                   /product="FLJ00076 protein"
FT                   /note="For this clone, GeneMark analysis triggered an alert
FT                   for spurious CDS split. The result of GeneMark analysis of
FT                   the nucleotide sequence of this clone is accessible through
FT                   http://www.kazusa.or.jp/NEDO."
FT                   /note="Start codon is not identified."
FT                   /db_xref="GOA:Q6PJG6"
FT                   /db_xref="H-InvDB:HIT000007756.17"
FT                   /db_xref="HGNC:HGNC:21701"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:4IFI"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6PJG6"
FT                   /protein_id="BAB15772.1"
FT                   /translation="AEDATERACGLTMDPECAQLLPALCAVLVDPRQPVADDTCLEKLL
FT                   DWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQY
FT                   LQQGELLPGLFGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFS
FT                   LQGDSSLFVASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAA
FT                   TPKVTQALNVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARS
FT                   GPRDAAGGPGWATVFLG"
XX
SQ   Sequence 4460 BP; 753 A; 1417 C; 1447 G; 843 T; 0 other;
     gcggaggacg caaccgagcg ggcctgcggc ctcaccatgg acccagaatg cgcccagctg        60
     ctcccggctc tctgtgctgt tctggtagat cccaggcagc cggtggcaga tgacacctgt       120
     ttggagaagc tcctggactg gtttaaaacg gtcactgaag gagagtccag tgtcgtgctg       180
     ctgcaggagc acccctgcct ggtggagctg ctgtcccatg tgctgaaagt ccaggacctg       240
     agttctgggg tcctctcctt ctcactgcgc ctggcaggaa ccttcgcagc ccaggaaaac       300
     tgcttccagt atcttcagca gggggagtta ctaccagggc tctttgggga gccaggaccc       360
     ctcggccgag caacctgggc cgtccccacc gtgcgcagcg gctggatcca gggcctgcgc       420
     tccctggcac agcaccccag cgccctgcgc ttcctggccg accatggtgc ggtcgacacc       480
     atcttctccc tgcagggaga ctccagcctg tttgtggcct cggcggccag tcagctcctg       540
     gtgcacgtcc tggctttgtc catgcgaggt ggagccgagg ggcagccctg cctgccgggg       600
     ggtgactggc ccgcgtgtgc ccagaagatc atggatcacg ttgaagagtc cttgtgctcc       660
     gcggccaccc ccaaggtcac tcaggccctg aacgtcctga ccacgacctt cgggcgctgc       720
     cagagcccct ggacagaagc cctgtgggtg cggctgagtc cccgcgtggc ctgtctgctg       780
     gagagagacc ccatccccgc cgcacactcg ttcgtggacc tgcttctctg tgtggctcgg       840
     tcagggcccc gggacgcagc tggggggcct gggtgggcaa ctgttttcct cggataatgc       900
     ccagggatgt cccactggca gccggagact ctctgaggac atggcctgca gtgaagcggc       960
     accggggtga ccctggaacc ctcatgggga aaggcctgtc ttgggctggg cgcctccagt      1020
     gccggagcca tggcagtctc agccaggcct cgaatggggt tttgagggtg ggggagtaat      1080
     ttttctctct ggggtctccc tgcagttctc ccgtgttcag ttcttccgac ggcagcctgt      1140
     gggagacagt ggcgcgggct ctgagctgcc tgggtcccac ccacatggga cccctggctt      1200
     tggggatcct gaagctcgag cactgtccac aggcactgag gacccaggcc ttccaggtcc      1260
     ttctccagcc cctggcctgt gtcctgaagg ccacggttca ggcccccgga cccccaggct      1320
     tgctggacgg gacggcagac gatgccacga cggtggacac actcctggcc tccaagtcgt      1380
     cctgcgccgg cctcctgtgc cgcaccctgg ctcacctgga ggagctgcag ccgctgcccc      1440
     agcgcccttc accgtggccc caggcgtctc tactgggggc tacagtgact gtcctgcggc      1500
     tctgtgacgg ctcggctgcc cctgcctcca gtgtgggggg ccacctctgt gggaccctgg      1560
     cgggctgcgt ccgggtccag cgagcagccc tcgacttcct ggggacgctg tcacagggga      1620
     caggccccca ggagctggtg acgcaggcgc ttgctgtcct cctggagtgc ctcgagagcc      1680
     ccggctccag ccccacggta cggtggtggg gatagagagc gaggagagga gggaggcaga      1740
     ggcagtggga cccacccctg actccacccc gtcccgtgca ggcctctgcg gatggggcct      1800
     tcacacaggg ccacagagct gctgctcaga gagcttcacg atgcaggtgg ctgcatgggg      1860
     cgggcccagg gcctcttgtt ggtgaagata catcagcacg caggggtgtg tggggccgtg      1920
     gggagcaggg gcactggtca ggcggcctgc ggggaattct ggacaaggga aatgaggtgg      1980
     caccaagacg gccctgggcg tgggctttgg gttctcctaa gcgccatttg tgaacgtgcc      2040
     tactccacag cccctcacgg agctgggccc tggcaggtac agaccttgtg ccacctgccg      2100
     ctgagcagac agcagacaac tttggaggaa gggcccaggg cttcttggga tcctaaggaa      2160
     aaggtgccct gcgtaattgg tcatgttttg atgtagaaat cccgttgcct gggttgtggg      2220
     tcttctggtg agggctgccg ccacctcctc ctgctcacag tctgggaagc cggttctgca      2280
     gcatattctg ccctattaaa atcagcccag gaggggcgtg gggctcacag ctgtgattac      2340
     tgtgcgttgg ggggccgagg tggggggatc aatggagccc aggacttttg aggccagcct      2400
     gggcaacata gcaagatccc atctctacaa aaaaatagaa aaattagccc caggagtata      2460
     gctcaggggt agagcatttg actgcaaaaa ttagccaggc gtggtgatgt gtgcctctag      2520
     ccccagctac tcatgaggct gaggcaggag gactgtttga gcctgggagg tggaggctgc      2580
     agtgaactgt gattgcagtc cagcctggat gacacattga gaccctgtct ctaaaaaaga      2640
     aggaagccca gcgttccctt ctctctccac ttcctgtccc cattgctgtc cctggagtac      2700
     gggcagcaca ggtgaaggcg agggggacag acagacagcc tgcccctccg tctcccgtgg      2760
     ccctgcagcc caccctatct gctccaggtt ctgaagaagg ccttccaggc cacgctcagg      2820
     tggctcctga gctcacccaa gacccccggc tgctctgatc tcggccccct catcccgcag      2880
     ttcctcagag agctgttccc tgtgctgcag aaacgcctgt gccacccctg ctgggaggtg      2940
     agggactccg ccctcgagtt cctgacccag ctgagcaggc actggggagg acaggctgac      3000
     ttcagatgcg cactcttggc ttcagaggtg cctcagctgg ccctgcagct cctccaggac      3060
     cctgagagtt atgtccgagc gagtgcagtg accgccatgg ggcagctgtc cagccagggc      3120
     ctgcacgccc ccaccagccc tgagcatgca gaggcccggc aggtaggagg tggcaggttc      3180
     ctcagccagc aactcccgcc tggccatcgt gtgtgctcgt ttgcttgcgg gtggtcgagc      3240
     ggccagcatg cagcgtggga gcagctgctg ctgtgggcag cgcctgcagc agtgactgcc      3300
     gaggccctgg ggctgtgctg ggtgtgggac ctgtgcgctt cgccttctgt ctccccagca      3360
     cccctccact tagacatggt tacctccatt tgacagatgg gtaaactgag gattggaggg      3420
     ccgtgtgctc actgcgcagc atgggaaggt gtcagagcgg gctgtggccc tagactgcat      3480
     gtccggggcc agcccccatc atgtaccgga gtcctgttgt gggagcctcg ctcctgccac      3540
     accaccaacc atccgcactt gctccctgtc ccccagagcc tgttcctgga gctcctgcac      3600
     atcctctccg tagactcgga gggcttccca cggcgggcgg tcatgcaagt cttcactgag      3660
     tggctgcggg acggccacgc cgacgcggcc caggacacgg agcagttcgt ggccactgtg      3720
     ctgcaggcgg cgagccagga cctggactgg gaggtccgcg cccagggcct ggagctggcc      3780
     ctcgtgttcc tgggccagac tttggggccg ccgcgtaccc actgccccta tgccgtggcc      3840
     ctacccgagg tggccccagc ccagccactc accgaggcac tgagggctct ctgccacgtg      3900
     gggctctttg acttcgcctt ttgtgccttg tttgactgcg accgccctgt ggcgcagaag      3960
     tcttgtgacc tccttctctt cctgagggac aagattgctt cctacagcag cctgcgggag      4020
     gccaggggca gccccaacac tgcctccgca gaggccaccc tgccgaggtg gcgggcgggt      4080
     gagcaggccc agcccccagg ggaccaggag cctgaggctg tgctggccat gctcaggtcc      4140
     ctagacctgg agggcctgcg gagcacgctg gccgagagca gcgaccacgt ggagaagagt      4200
     ccccagtccc tcctgcagga catgctggcc acgggaggct tcctgcaggg ggacgaggcc      4260
     gactgctact gagcagaacc agactctgcc actggggctc aggaccaagg gaggcagcac      4320
     catgtccttc tgtgggacac tgccagcccc agggctccag cccagcccgg tggatcctct      4380
     ggggaagcca ggaccaggag agaagcaagg tcaagaaatc ccacagtttg atgtattaaa      4440
     gaaatgactt atttctactc                                                  4460
//


spacer
spacer