spacer

EBI Dbfetch

ID   AK023650; SV 1; linear; mRNA; STD; HUM; 2260 BP.
XX
AC   AK023650;
XX
DT   29-SEP-2000 (Rel. 65, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens cDNA FLJ13588 fis, clone PLACE1009298, weakly similar to
DE   VACUOLAR PROTEIN SORTING-ASSOCIATED PROTEIN VPS35.
XX
KW   fis (full insert sequence); FLI_CDNA; oligo capping.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2260
RA   Isogai T., Otsuki T.;
RT   ;
RL   Submitted (23-AUG-2000) to the INSDC.
RL   Contact:Takao Isogai Helix Research Institute, Genomics Laboratory; 1532-3
RL   Yana, Kisarazu, Chiba 292-0812, Japan E-mail :flj-cdna@nifty.com
XX
RN   [2]
RX   DOI; 10.1038/ng1285.
RX   PUBMED; 14702039.
RA   Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
RA   Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
RA   Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
RA   Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
RA   Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
RA   Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
RA   Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
RA   Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
RA   Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
RA   Tanase T., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M.,
RA   Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
RA   Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S.,
RA   Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S.,
RA   Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H.,
RA   Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M.,
RA   Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M.,
RA   Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y.,
RA   Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N.,
RA   Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S.,
RA   Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T.,
RA   Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M.,
RA   Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y.,
RA   Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y.,
RA   Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T.,
RA   Sugano S.;
RT   "Complete sequencing and characterization of 21,243 full-length human
RT   cDNAs";
RL   Nat Genet 36(1):40-45(2004).
XX
RN   [3]
RA   Isogai T., Ota T., Hayashi K., Sugiyama T., Otsuki T., Suzuki Y.,
RA   Nishikawa T., Nagai K., Sugano S., Shiratori A., Sudo H., Wagatsuma M.,
RA   Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
RA   Chiba Y., Ishida S., Murakawa K., Ono Y., Takiguchi S., Watanabe S.,
RA   Kimura K., Murakami K., Ishii S., Kawai Y., Saito K., Yamamoto J.,
RA   Wakamatsu A., Nakamura Y., Nagahari K., Masuho Y., Ninomiya K.,
RA   Iwayanagi T.;
RT   "NEDO human cDNA sequencing project";
RL   Unpublished.
XX
DR   MD5; 9b5bdc308bb80674fa127468c0e40176.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
CC   NEDO human cDNA sequencing project supported by Ministry of
CC   International Trade and Industry of Japan; cDNA full insert
CC   sequencing: Research Association for Biotechnology; cDNA library
CC   construction, 5'- & 3'-end one pass sequencing and clone
CC   selection: Helix Research Institute (supported by Japan Key
CC   Technology Center etc.) and Department of Virology, Institute of
CC   Medical Science, University of Tokyo.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2260
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone_lib="PLACE1"
FT                   /clone="PLACE1009298"
FT                   /tissue_type="placenta"
FT                   /note="cloning vector: pME18SFL3"
FT                   /db_xref="taxon:9606"
FT   CDS             16..2001
FT                   /codon_start=1
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000006924.16"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /protein_id="BAB14626.1"
FT                   /translation="MCRGVQHPLRGLFLRNYLLQCTRNTLPDEGEPTDEETTGDISDSM
FT                   DFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYK
FT                   QIVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNI
FT                   IIALIDRLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINL
FT                   AMKCYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVL
FT                   KLKHFHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQP
FT                   VEDPDPEDFADEQSLVGRFIHLLRSEDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVF
FT                   AAYQLAFRYKENSKVDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGE
FT                   IGFENHETVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQ
FT                   CALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCM
FT                   DPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHF
FT                   HNTLEHLRLRRESPESEGPIYEGLIL"
XX
SQ   Sequence 2260 BP; 681 A; 452 C; 487 G; 640 T; 0 other;
     aaagatttgg tagaaatgtg ccgtggtgtg caacatccct tgaggggtct gtttcttcga        60
     aattaccttc ttcagtgtac cagaaatacc ttacctgatg aaggagagcc aacagatgaa       120
     gaaacaactg gtgacatcag tgattccatg gattttgtac tgctcaactt tgcagaaatg       180
     aacaagctct gggtgcgaat gcagcatcag ggacatagcc gagatagaga aaaaagagaa       240
     cgagaaagac aagaactgag aattttagtg ggaacaaatt tggtgcgcct cagtcagttg       300
     gaaggtgtaa atgtggaacg ttacaaacag attgttttga ctggcatatt ggagcaagtt       360
     gtaaactgta gggatgcttt ggctcaagaa tatctcatgg agtgtattat tcaggttttc       420
     cctgatgaat ttcacctcca gactttgaat ccttttcttc gggcctgtgc tgagttacac       480
     cagaatgtaa atgtgaagaa cataatcatt gctttaattg atagattagc tttatttgct       540
     caccgtgaag atggacctgg aatcccagcg gatattaaac tttttgatat attttcacag       600
     caggtggcta cagtgataca gtctagacaa gacatgcctt cagaggatgt tgtatcttta       660
     caagtctctc tgattaatct tgccatgaaa tgttaccctg atcgtgtgga ctatgttgat       720
     aaagttctag aaacaacagt ggagatattc aataagctca accttgaaca tattgctacc       780
     agtagtgcag tttcaaagga actcaccaga cttttgaaaa taccagttga cacttacaac       840
     aatattttaa cagtcttgaa attaaaacat tttcacccac tctttgagta ctttgactac       900
     gagtccagaa agagcatgag ttgttatgtg cttagtaatg ttctggatta taacacagaa       960
     attgtctctc aagaccaggt ggattccata atgaatttgg tatccacgtt gattcaagat      1020
     cagccagatc aacctgtaga agaccctgat ccagaagatt ttgctgatga gcagagcctt      1080
     gtgggccgct tcattcatct gctgcgctct gaggaccctg accagcagta cttgattttg      1140
     aacacagcac gaaaacattt tggagctggt ggaaatcagc ggattcgctt cacactgcca      1200
     cctttggtat ttgcagctta ccagctggct tttcgatata aagagaattc taaagtggat      1260
     gacaaatggg aaaagaaatg ccagaagatt ttttcatttg cccaccagac tatcagtgct      1320
     ttgatcaaag cagagctggc agaattgccc ttaagacttt ttcttcaagg agcactagct      1380
     gctggggaaa ttggttttga aaatcatgag acagtcgcat atgaattcat gtcccaggca      1440
     ttttctctgt atgaagatga aatcagcgat tccaaagcac agctagctgc catcaccttg      1500
     atcattggca cttttgaaag gatgaagtgc ttcagtgaag agaatcatga acctctgagg      1560
     actcagtgtg cccttgctgc atccaaactt ctaaagaaac ctgatcaggg ccgagctgtg      1620
     agcacctgtg cacatctctt ctggtctggc agaaacacgg acaaaaatgg ggaggagctt      1680
     cacggaggca agagggtaat ggagtgccta aaaaaagctc taaaaatagc aaatcagtgc      1740
     atggacccct ctctacaagt gcagcttttt atagaaattc tgaacagata tatctatttt      1800
     tatgaaaagg aaaatgatgc ggtaacaatt caggttttaa accagcttat ccaaaagatt      1860
     cgagaagacc tcccgaatct tgaatccagt gaagaaacag agcagattaa caaacatttt      1920
     cataacacac tggagcattt gcgcttgcgg cgggaatcac cagaatccga ggggccaatt      1980
     tatgaaggtc tcatccttta aaaaggaaat agctcaccat actcctttcc atgtacatcc      2040
     agtgagggtt ttattacgct aggtttccct tccatagatt gtgcctttca gaaatgctga      2100
     ggtaggtttc ccatttctta cctgtgatgt gttttaccca gcacctccgg acactcacct      2160
     tcaggacctt aataaaatta ttcacttggt aagtgttcaa gtctttctga tcaccccaag      2220
     tagcatgact gatctgcaat ttaaaattcc tgtgatctgt                            2260
//


spacer
spacer