Dbfetch

ID   AK021164; SV 1; linear; mRNA; HTC; MUS; 2294 BP.
XX
AC   AK021164;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 16 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:C130077B15 product:frizzled homolog 9 (Drosophila), full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2294
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 388185e5ed2ec85cad9fd7b50227717d.
DR   Ensembl-Gn; ENSMUSG00000049551; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062572; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C130077B15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2294
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="16 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C130077B15"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             203..1981
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="frizzled homolog 9 (Drosophila) (MGD|MGI:1313278
FT                   GB|AK021164, evidence: BLASTN, 100%, match=2294)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9R216"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:1313278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R216"
FT                   /protein_id="BAB32311.1"
FT                   /translation="MAVPPLLRGALLLWQLLATGGAALEIGRFDPERGRGPAPCQAMEI
FT                   PMCRGIGYNLTRMPNLLGHTSQGEAAAHCAEFSPLVQYGCHSHLRFFFCSLYAPMCTDQ
FT                   VSTPIPACRPMCEQARLRCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAG
FT                   PTEPHKGLGMLPVAPRPARPPGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEV
FT                   FWSRRDKDFALVWMAVWSALCFFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLA
FT                   FLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWF
FT                   LAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAAL
FT                   TGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTV
FT                   PATCVIVCYVYERLNMDFWRLRATEQPCTAATVPGGRRDCSLPGGSVPTVAVFMLKIFM
FT                   SLVVGITSGVWVWSSKTFQTWQSLCYRKMAAGRARAKACRTPGGYGRGTHCHYKAPTVV
FT                   LHMTKTDPSLENPTHP"
FT   regulatory      2277..2282
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2294
FT                   /note="putative"
XX
SQ   Sequence 2294 BP; 407 A; 712 C; 714 G; 461 T; 0 other;
     ggacgccggc tctggctgga gtggcggcgg catcggcggc ggcggcgacg gcggtggtag        60
     cggttgttcc tccgaaggcg ccacgcgctc cgggacacac gtgggcggcc gagagatggc       120
     gcgggagccg cgacgtggcg cgcagatccc gggacgcggg atggagcggt gcgagtgagc       180
     ccgagcggcc gcgcccgggg cgatggccgt gccaccgctg ctccgcgggg cgctgctgct       240
     gtggcagctg ctggcgacgg gcggcgcggc gctggagatc ggccgcttcg atccggagcg       300
     tggccgtggc cccgcaccgt gccaagcgat ggagatcccc atgtgccggg gcattggcta       360
     caacctgacc cgcatgccca acctactggg ccacacgtcg cagggcgagg cggcggcgca       420
     ctgtgccgag ttctcgcccc tcgtgcagta cggctgccac agccacctgc gcttcttctt       480
     ctgctcgctc tacgccccaa tgtgcaccga ccaggtctcc actcccatcc cagcctgccg       540
     gcccatgtgc gagcaggctc gcctgcgctg cgcccccatc atggagcaat tcaatttcgg       600
     ctggcccgac tcactcgact gtgcccggct ccccacgcgc aacgacccgc acgcactctg       660
     tatggaggca cccgagaacg ctacagcagg ccccacagaa ccccacaagg gcctgggcat       720
     gctccctgtg gcacctcggc ccgcgaggcc accgggagat tcagccccag gtcccggcag       780
     cggtggcacc tgcgacaacc ccgagaagtt ccagtacgtg gagaagagtc gctcgtgcgc       840
     tccgcgctgc gggccaggcg tcgaggtgtt ctggtctcgg cgcgataagg acttcgcgct       900
     ggtttggatg gctgtgtggt ccgcgttgtg tttcttctcc acggccttca ccgtgttcac       960
     cttcctgctg gagcctcacc ggttccagta cccagagcgc ccgattatct tcctttctat      1020
     gtgctacaat gtctactcct tggccttcct gatcagagcg gtggcaggtg cacagagtgt      1080
     ggcatgcgac caggaggcag gggctctgta tgtgatccag gagggtctgg aaaacacagg      1140
     ctgcaccctg gtcttcctgt tgctctatta tttcgggatg gccagctcac tttggtgggt      1200
     ggttttgact ctaacctggt tcctggctgc aggcaaaaaa tggggccacg aggccatcga      1260
     ggctcacggc agctacttcc acatggcagc gtggggcctg ccagcactca aaactatcgt      1320
     ggtcctgact ctgcgcaagg tggctggcga tgaactgact gggctctgct atgtagccag      1380
     catggacccg gcagccctca ctggctttgt gttggtaccc ctatcttgct acctggtact      1440
     gggtaccagt ttcctcctga ccggttttgt ggctctcttc catatccgca aaatcatgaa      1500
     gacgggaggc accaatacgg agaagctgga gaagctgatg gtcaaaatcg gagtcttttc      1560
     catcctttac acagtgccgg ccacctgcgt cattgtctgc tacgtttatg aacgcctcaa      1620
     catggacttc tggcggcttc gggccacaga gcaaccatgt actgctgcca ccgtgcctgg      1680
     aggccggaga gactgctcgc tgccaggggg ctcggtgccc actgtggctg tcttcatgct      1740
     caaaatcttc atgtccttgg tggtgggcat caccagtgga gtctgggtat ggagttccaa      1800
     gacttttcag acttggcaga gcctgtgcta ccgaaaaatg gcagctggcc gagcccgggc      1860
     caaggcctgc cgaaccccag ggggctatgg ccggggtacc cactgccact acaaagcccc      1920
     cacggtggtc ttgcacatga ctaagacaga cccctctctg gagaacccca cacaccccta      1980
     gaacataggc taggctgtga gttatggttg ctccctcctt gccctcccct ccccccttca      2040
     gagacagctg actaacagct gcccagctgt caaggtcaga caagtgagac acagggggct      2100
     gaggactagg gtggggaccc agtaaagctc agggccttga ccttctgtct catgcaggga      2160
     gtggtcctag tccacagagg gtcccaggat aagaaggggc agaagggggc agggtccagt      2220
     gcagagttat ttaatgatgt aatttattgt ggcatttctc tggaagctgt gactggaata      2280
     aaccctcgtg tggc                                                        2294
//