spacer

EBI Dbfetch

ID   AK020368; SV 1; linear; mRNA; HTC; MUS; 730 BP.
XX
AC   AK020368;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 19)
XX
DE   Mus musculus adult male diencephalon cDNA, RIKEN full-length enriched
DE   library, clone:9330127I20 product:similar to RYANODINE RECEPTOR 3
DE   (FRAGMENT) [Sus scrofa], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-730
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c60ea97b3caf0c8f142f84b21a692b3f.
DR   Ensembl-Gn; ENSMUSG00000021313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021750; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9330127I20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..730
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9330127I20"
FT                   /tissue_type="diencephalon"
FT                   /db_xref="taxon:10090"
FT   CDS             243..>730
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="similar to RYANODINE RECEPTOR 3 (FRAGMENT) [Sus
FT                   scrofa] (SPTR|Q9MYU5, evidence: FASTY, 75.4%ID, 100%length,
FT                   match=168)"
FT                   /db_xref="GOA:Q9CTT8"
FT                   /db_xref="InterPro:IPR013333"
FT                   /db_xref="InterPro:IPR014821"
FT                   /db_xref="InterPro:IPR015925"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="MGI:MGI:99685"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CTT8"
FT                   /protein_id="BAB32083.3"
FT                   /translation="MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNR
FT                   LCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGKFMMKTAQGGGHR
FT                   TLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRS
FT                   "
XX
SQ   Sequence 730 BP; 154 A; 207 C; 225 G; 144 T; 0 other;
     ggctgggctc tcggcaccag cagcgcggcc ccccgggtgc ctcgggctcc tggctgtggc        60
     cgccgcaggg gcagcgaccc gagtagcagc cgttggagcc cctagaacat cctggttagc       120
     agtgactaga gcgtccagag aagccgcagc agcagcttca gcagtagcag cagcagcata       180
     agtggccgcg gtcgtggggc tccgccgggc tccggagccg gccgggccag gagcgcggag       240
     ccatggctga tgcgggcgaa ggcgaggatg agatccagtt cctgagaact gatgatgagg       300
     tggttctgca gtgcacggcg accatccaca aagaacagca gaagctgtgc ttggcagcag       360
     aaggatttgg caacagactt tgttttttgg agtctacttc caattccaag aatgttcccc       420
     cggacctgtc tatctgcacc tttgtgctgg agcagtccct gtcagtacgg gccctgcagg       480
     agatgctggc caacacagtg gaaaagtcag aagggaagtt catgatgaag actgctcaag       540
     gtggaggcca ccggacactc ctctatggac acgccatatt gctacgccat tcctacagtg       600
     gtatgtatct ttgctgtctc tccacctccc ggtcttccac tgacaaactg gccttcgatg       660
     ttggccttca agaggatacc acaggggagg cttgctggtg gaccatacat cctgcctcta       720
     agcagagatc                                                              730
//


spacer
spacer