spacer

EBI Dbfetch

ID   AK020292; SV 1; linear; mRNA; HTC; MUS; 1735 BP.
XX
AC   AK020292;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male cecum cDNA, RIKEN full-length enriched library,
DE   clone:9130404C19 product:matrix metalloproteinase 10, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1735
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 74d4b5aa5916cae28158bb12837f239b.
DR   Ensembl-Gn; ENSMUSG00000047562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034488; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9130404C19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1735
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9130404C19"
FT                   /tissue_type="cecum"
FT                   /db_xref="taxon:10090"
FT   CDS             54..1484
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="matrix metalloproteinase 10 (MGD|MGI:97007)"
FT                   /note="putative"
FT                   /db_xref="GOA:O55123"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021158"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:97007"
FT                   /protein_id="BAB32058.1"
FT                   /translation="MEPLAILALLSLPICSAYPLHGAVTQGHPSMDLAQQYLEKYYNFK
FT                   KNEKQIFKRKDSSPVVKKIQEMQKFLGLEMTGKLDSNTMELMHKPRCGVPDVGGFSTFP
FT                   GSPKWRKSHITYRIVNYTPDLPRQSVDSAIEKALKVWEEVTPLTFSRISEGEADIMISF
FT                   AVGEHGDFYPFDGPGQSLAHAYPPGPGFYGDVHFDDDEKWTLAPSGTNLFLVAAHELGH
FT                   SLGLFHSDKKESLMYPVYRFSTSPANFHLSQDDIEGIQSLYGAGPSSDATVVPVLSVSP
FT                   RPETPDKCDPALSFDSVSTLRGEVLFFKDRYFWRRSHWNPEPEFHLISAFWPTLPSDLD
FT                   AAYEAHNTDSVLIFKGSQFWAVRGNEVQAGYPKGIHTLGFPPTVKKIDAAVFEKEKKKT
FT                   YFFVGDKYWRFDETRHVMDKGFPRQITDDFPGIEPQVDAVLHEFGFFYFFRGSSQFEFD
FT                   PNARTVTHILKSNSWLLC"
FT   polyA_signal    1712..1717
FT                   /note="putative"
FT   polyA_site      1735
FT                   /note="putative"
XX
SQ   Sequence 1735 BP; 478 A; 399 C; 400 G; 458 T; 0 other;
     gatggaaacc aggtgctaga gaaggatcgg tttttaaagt aaagactgtc tgtatggagc        60
     cactagccat cctggcactg ctgagcctac caatctgctc agcgtatcct ctgcatgggg       120
     cagtgacaca aggccaccca agcatggatc ttgctcagca atacctagaa aaatactaca       180
     actttaaaaa aaatgagaaa caaattttca aaagaaagga cagtagtcct gttgtcaaaa       240
     aaattcaaga aatgcagaag ttcctcgggt tggagatgac agggaagctg gactccaaca       300
     ctatggagct gatgcacaag cccaggtgtg gtgttcctga tgttggtggc ttcagtacct       360
     tcccaggttc gccaaaatgg aggaaatccc acatcaccta caggattgtg aattatacac       420
     cagatttgcc aagacagagt gtggattctg ccattgagaa agctttgaag gtctgggagg       480
     aggtgacccc actcactttc tccaggatct ctgaaggaga ggctgacata atgatctcct       540
     ttgcagttgg agaacacgga gacttttacc cttttgatgg gccaggacag agtctggctc       600
     atgcctaccc acctggccct ggattttatg gagatgttca cttcgatgat gatgagaaat       660
     ggacacttgc accctcaggg accaacttat tcctggttgc agcccatgaa cttggccact       720
     ccctgggtct ctttcattcc gacaagaaag aatctctgat gtacccagtc tacaggttct       780
     ccacaagccc agctaacttc cacctttctc aagatgatat agagggcatt caatccctgt       840
     atggagccgg tccctcctcc gatgccacag tggttcctgt gttgtctgtc tctccaagac       900
     ctgagacccc agacaaatgt gatcctgctt tgtcctttga ttcagtcagc acgctgagag       960
     gggaagtcct attctttaaa gacaggtact tctggcgcag atcccattgg aatcccgagc      1020
     ctgaatttca tttgatatca gcattttggc ccactcttcc ttcagactta gatgctgcct      1080
     atgaggctca caacacggac agtgttctga tttttaaagg aagtcagttc tgggcagtcc      1140
     gaggaaatga agtccaagca ggctacccaa aggggatcca cactctcggt tttcctccca      1200
     ccgtgaagaa gattgatgca gctgtttttg aaaaggagaa gaagaaaacg tacttctttg      1260
     taggggacaa atactggaga tttgatgaga caagacatgt tatggataaa ggcttcccaa      1320
     gacagataac agatgatttt ccaggaattg agccacaagt tgatgctgtg ttacacgaat      1380
     ttgggttttt ttatttcttc cgaggatcat cacagttcga gtttgacccc aatgccagga      1440
     cggtgacaca catactgaag agcaacagct ggctgctgtg ctgatcatca tgacaagaca      1500
     tatacaaccc tgtaaaatga gtctcatgac ttcccaccta ctttattatg tgtcagaatg      1560
     attagttgct cctgcatgtt ctgtggctcc ggatgagcgc agcagatgtc tttcataatg      1620
     agtcacaaag catcacctga gcacagaagt gaaattttct cactgcagta ggtgagagga      1680
     tgcatccatc cccatgggta ttttattatt taataaagag ctttattttt gaacc           1735
//


spacer
spacer