Dbfetch

ID   AK020065; SV 1; linear; mRNA; HTC; MUS; 1152 BP.
XX
AC   AK020065;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 13 days embryo male testis cDNA, RIKEN full-length enriched
DE   library, clone:6030445P13 product:myotubularin related protein 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1152
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d2e1cfcc30118a1420a3ed80c9958fb4.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=6030445P13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="6030445P13"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             429..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="myotubularin related protein 2 (MGD|MGI:1924366,
FT                   evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="MGI:MGI:1924366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V415"
FT                   /protein_id="BAE43257.1"
FT                   /translation="MEEPALLPGENIKDMAKDVTYICPFTGAVRGTLTVTSYRLYFKSM
FT                   ERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIF
FT                   ENLMKYAFPVSNGLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPNESWRITKINERYE
FT                   LCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATVTRCSQPMVGVSGK
FT                   RSKEDEKYLQAIMDSNAQS"
XX
SQ   Sequence 1152 BP; 306 A; 276 C; 300 G; 270 T; 0 other;
     gaggctgggg gaacatggcc gcttccggtc tcggagcctg cctggcgcgg ggctgaccgc        60
     ggctgcggcc ccgtgcgctc ctccctctgc atctcgcgcc ggcggccgcg gagggcgcag       120
     cggcctccag tttctcgcgc catggagaag agctccagct gcgagagtct cggcgcgcag       180
     ctcccggcgg caaggctgcc cagcgaggac tcactgtcca gttaatgtgt taagaaccat       240
     tgacatttga agatcatcag aagtgaagat aaaacatctc aaaaattata attgcttcta       300
     cttctcattc agagaactcg gtgcatacca aatcagcttc tgctatatca tcagattcca       360
     tttcaacctc tgcagacaac ttttctcctg acttgagggt cctgagggag gcaaacaagt       420
     tagcagaaat ggaggaacca gccctgcttc caggagagaa cattaaagat atggccaaag       480
     atgtgactta catatgtcca ttcactggtg ctgtgcgagg aacgctgact gtcacaagtt       540
     acaggttata tttcaagagc atggagcggg accccccatt tgttctagat gcttctcttg       600
     gagtgataag tagagtagaa aaaattggtg gtgcatctag ccgaggtgaa aactcctatg       660
     gcctggaaac tgtgtgcaag gatatcagga acttgcgatt tgctcataaa ccggaggggc       720
     gaacaagaag atccatattt gagaatctaa tgaaatatgc atttcctgtg tctaatggct       780
     tgcctctttt tgcttttgag tataaagaag tattccccga aaatgggtgg aaactgtatg       840
     acccccttct agagtacaga aggcagggaa ttccaaatga aagctggaga ataacaaaga       900
     taaatgaacg ctatgaactc tgtgacacat atcctgccct cttggttgtg ccagcaaaca       960
     ttcctgatga ggagctaaag agagtggcat cctttaggtc acggggccgg atcccagttt      1020
     tatcctggat tcatcctgaa agtcaagcca cagtcactcg ctgcagccag cccatggttg      1080
     gagtgagtgg gaagcgcagc aaagaagatg agaagtacct tcaggccatc atggactcca      1140
     atgcccagtc tc                                                          1152
//