Dbfetch

ID   AK019271; SV 1; linear; mRNA; HTC; MUS; 926 BP.
XX
AC   AK019271;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10, 11 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2810431G11 product:glutathione S-transferase, alpha 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-926
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 843d1fb438110fcccf23890ec280d87c.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035059; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035040; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034969; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035550; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034063; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034713; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034873; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034815; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034954; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034856; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035573; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033767; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034175; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0093403; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093348; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093323; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0092899; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0093840; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093513; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0092827; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093035; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0092884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093041; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0092875; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094156; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0092926; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0091911; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2810431G11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..926
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10, 11 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2810431G11"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             95..763
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, alpha 4 (MGD|MGI:1309515
FT                   GB|NM_010357, evidence: BLASTN, 99%, match=900)"
FT                   /note="putative"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="BAB31640.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLDTREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
FT                   "
FT   regulatory      913..918
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      926
FT                   /note="putative"
XX
SQ   Sequence 926 BP; 266 A; 222 C; 237 G; 201 T; 0 other;
     ggcaggacgg tgaactttcg ctcgcagaac cgcttctttc cagtgcctgg agacaacaat        60
     cccacaagaa taaggaagct ctgaagcagg agtcatggca gccaaaccta agctctacta       120
     ctttaatggc aggggacgga tggagtcgat ccgctggctg ctggctgcgg ctggagtgga       180
     gtttgaggaa gaatttcttg acacaaggga acagtatgag aagatgcaaa aggatggaca       240
     cctgcttttc ggccaagtac ccttggttga aatcgatggg atgatgctga cacagaccag       300
     ggccatcctc agctacctcg ctgccaagta caacttgtat gggaaggacc tgaaggagag       360
     agtcaggatt gacatgtatg cagatggcac ccaggacctg atgatgatga ttgccgtggc       420
     tccatttaaa acccccaagg aaaaagagga gagctatgat ttgatactgt caagagctaa       480
     aacccgttac ttcccagtgt ttgaaaagat tttaaaagac cacggagagg cttttctcgt       540
     tggcaaccag ctcagttggg cagacatcca gctcctagaa gccattttga tggtggaaga       600
     actcagtgcc cctgtactgt ccgacttccc tctgctgcag gcatttaaga caagaatcag       660
     caacattcct acaattaaga agttcctgca acccggaagt cagaggaagc ctcctccaga       720
     tggcccctat gttgaggtgg tcaggactgt cctgaagttc tagtgcagcg tgctttaagg       780
     tggcacccac aaggttccaa ttgcagtgtc accacaggcc agctgcagag cattccagaa       840
     gcaaggtata tagatcccag gagtcaagct cttcaaacaa caaaaccact ctgcccacaa       900
     tgacaaatgc caattaaata cagtgg                                            926
//