spacer

EBI Dbfetch

ID   AK019132; SV 1; linear; mRNA; HTC; MUS; 649 BP.
XX
AC   AK019132;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410129I19 product:FK506 BINDING PROTEIN PRECURSOR homolog [Homo
DE   sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-649
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e39fb883c08f99c9a78f851b5d1a8a31.
DR   Ensembl-Gn; ENSMUSG00000003355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003445; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410129I19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..649
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410129I19"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             56..>649
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="FK506 BINDING PROTEIN PRECURSOR homolog [Homo
FT                   sapiens] (SPTR|Q9NYL4, evidence: FASTY, 90.4%ID, 98%length,
FT                   match=591)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1M7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="MGI:MGI:1913370"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1M7"
FT                   /protein_id="BAB31559.1"
FT                   /translation="MTLSPLLLPLQLLLLLLFSGAVCRAEAGPETESPVRTLQVETLVQ
FT                   PPESCTEFAAIGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMC
FT                   VGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVELIALIRANYWQKLLKSILPLVGIA
FT                   MVPALLGLIGYHLYRKASRPKVSKKKLKEEKRNKR"
XX
SQ   Sequence 649 BP; 152 A; 177 C; 184 G; 136 T; 0 other;
     ggcgtgcacc cgaacagcct gccctggtat cctggtgctc tgacccggtc caatcatgac        60
     cctgagccct ttgctcctac cactccagct gttactgctg ctactgttca gtggggcggt       120
     gtgccgggct gaggctgggc cagaaaccga aagtcctgtc cggaccctcc aagtggagac       180
     cctggtgcag ccccctgaat cgtgcacgga atttgctgcc attggagaca cgctccacat       240
     acactacacg ggcagtttgg tagatggacg cattattgac acttctctga ccagagatcc       300
     tctggtcata gaactcggcc aaaagcaggt gattccaggt ctggagcaga gccttttgga       360
     catgtgtgtg ggagagaagc gaagagcagt cattccttct cacctggctt atggaaagcg       420
     agggtacccg ccatctatcc cagccgatgc agtggtgcag tacgatgtgg agctgatcgc       480
     tttgattcga gccaactact ggcagaagct gctaaagagc attttgcctc tggtaggcat       540
     cgccatggtg ccggcgctcc tggggctgat cgggtatcac ctgtacagaa aggccagcag       600
     acccaaagtc tccaaaaaga agctaaaaga ggagaaacga aacaagagg                   649
//


spacer
spacer