Dbfetch

ID   AK019093; SV 2; linear; mRNA; HTC; MUS; 2390 BP.
XX
AC   AK019093;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male tongue cDNA, RIKEN full-length enriched library,
DE   clone:2310045E22 product:frizzled-related protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2390
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (18-AUG-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c08e64d4399f4bf2d85016db77720808.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025078; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025147; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055544; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055247; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055405; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055255; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054520; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2310045E22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2390
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2310045E22"
FT                   /tissue_type="tongue"
FT                   /db_xref="taxon:10090"
FT   CDS             228..1199
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="frizzled-related protein (MGD|MGI:892032)"
FT                   /note="putative"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="BAB31542.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS"
XX
SQ   Sequence 2390 BP; 598 A; 571 C; 597 G; 624 T; 0 other;
     gtagacgctt gggaagagca gccggcgcag cgaggcaccg ggctccgcca agctagtgga        60
     ccggacctgg gagcacttgg atccaagaga actgtgattg tcccaggggt gggggcagct       120
     ccccaggtcg ttgggatcac ccctcggaac cgcaggggga gacttcggaa cgaaagtgtc       180
     tcccgcgtcc gtcgctcggc tgcgccctgc cccatcctgc tgggaccatg gtctgctgcg       240
     gcccgggacg gatgctgcta ggatgggccg ggttgctagt cctggctgct ctctgcctgc       300
     tccaggtgcc cggagctcag gctgcagcct gtgagcctgt ccgcatcccg ctgtgcaagt       360
     cccttccctg gaacatgacc aagatgccca accacctgca ccacagcacc caggctaacg       420
     ccatcctggc catggaacag ttcgaagggc tgctgggcac ccactgcagc ccggatcttc       480
     tcttcttcct ctgtgcaatg tacgcaccca tttgcaccat cgacttccag cacgagccca       540
     tcaagccctg caagtctgtg tgtgagcgcg cccgacaggg ctgcgagccc attctcatca       600
     agtaccgcca ctcgtggccg gaaagcttgg cctgcgacga gctgccggtg tacgaccgcg       660
     gcgtgtgcat ctctcctgag gccatcgtca ccgcggacgg agcggatttt cctatggatt       720
     caagtactgg acactgcaga ggggcaagca gcgaacgttg caaatgtaag cctgtcagag       780
     ctacacagaa gacctatttc cggaacaatt acaactatgt catccgggct aaagttaaag       840
     aggtaaagat gaaatgtcat gatgtgaccg ccgttgtgga agtgaaggaa attctaaagg       900
     catcactggt aaacattcca agggacaccg tcaatcttta taccacctct ggctgcctct       960
     gtcctccact tactgtcaat gaggaatatg tcatcatggg ctatgaagac gaggaacgtt      1020
     ccaggttact cttggtagaa ggctctatag ctgagaagtg gaaggatcgg cttggtaaga      1080
     aagtcaagcg ctgggatatg aaactccgac accttggact gggtaaaact gatgctagcg      1140
     attccactca gaatcagaag tctggcagga actctaatcc ccggccagca cgcagctaaa      1200
     tcctgaaatg taaaaggcca cacccacgga ctcccttcta agactggcgc tgctggacta      1260
     acaaaggaaa accgcacagt tgtgctcgtg accgattgtt taccgcagac accgcgtggc      1320
     taccgaagtt acttccggtc ccctttctcc tgcttcttaa tggcctgggg ttagatcctt      1380
     taatatgtta tatattctgt ttcatcaatc acgtggggac tgttcttttg caaccagaat      1440
     agtaaattaa atatgttgat gctaaggttt ctgtactgga ctccctgggt ttaatttggt      1500
     gttctgtacc ctgattgaga atgcaatgtt tcatgtaaag agagaatcct ggtcatatct      1560
     caagaactag atattgctgt aagacagcct ctgctgctgc gcttatagtc ttgtgtttgt      1620
     atgcctttgg ccatttccct catgctgtga aagttataca tgtttataaa ggtagaaggg      1680
     cattttgaaa tcagacactg cacaagcaga gtagcccaac accaggaagc atttatgagg      1740
     aaacgccaca cagcatgact tattttcaag attggcaggc agcaaaataa atagtgttgg      1800
     gagccaagaa aagaatattt tgcctggtta aggggcacac tggaatcagt agcccttgag      1860
     ccattaacag cagtgttctt ctggcaacgt ttttgatttg ttcataaatg tattcacgag      1920
     cattagagat gaacttataa ctagacatct gttgttatca ctatagctct gcttccttct      1980
     aaatcaaacc cattgttgga tgctccctct ccattcataa ataaatttgg cttgctgtat      2040
     tggccaggaa aagaaagtat taaagtatgc atgcatgtgc accagggtgt tatttaacag      2100
     aggtatgtaa ctctataaaa gactataatt tacaggacac ggaaatgtgc acatttgttt      2160
     actttttttc ttccttttgc tttgggcttg tgattttggt ttttggtgtg tttatgtctg      2220
     tattttgggg ggtgggtagg tttaacgcca ttgcatattc aagttgaact agattagagt      2280
     agactaggct cattggccta gacattatga tttgaatttg tgttgtttaa tgctccatca      2340
     agatgtctaa taaaaggaat atggttgtca acagagacga caacaacaac                 2390
//