Dbfetch

ID   AK018524; SV 1; linear; mRNA; HTC; MUS; 1685 BP.
XX
AC   AK018524;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 19)
XX
DE   Mus musculus adult male colon cDNA, RIKEN full-length enriched library,
DE   clone:9030422N06 product:twisted gastrulation protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1685
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; af6e98bf84b604c8e618206bf594cb9e.
DR   Ensembl-Gn; ENSMUSG00000024098; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023982; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0023940; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0023909; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023941; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023705; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023187; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0023681; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0023809; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0023775; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0023891; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023803; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024431; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022933; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023253; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000024906; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0048414; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0048397; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0048354; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0048357; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0048103; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0048847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0048167; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0048028; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0048128; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0048095; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0048239; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0048100; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0048943; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0047755; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0047406; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=9030422N06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1685
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="9030422N06"
FT                   /tissue_type="colon"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..194
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="twisted gastrulation protein (MGD|MGI:2137520
FT                   GB|NM_023053, evidence: BLASTN, 99%, match=1683)"
FT                   /db_xref="GOA:Q9EP52"
FT                   /db_xref="InterPro:IPR006761"
FT                   /db_xref="MGI:MGI:2137520"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EP52"
FT                   /protein_id="BAC25557.1"
FT                   /translation="SDKERMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIG
FT                   PECIDYGSKTVKCMNCMF"
FT   regulatory      1666..1671
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1685
FT                   /note="putative"
XX
SQ   Sequence 1685 BP; 458 A; 347 C; 392 G; 488 T; 0 other;
     ttagcgacaa agagcgcatg tgcacagtgg tttactttga tgactgcatg tccatccacc        60
     agtgtaagat atcctgcgaa tccatgggtg catccaagta tcgctggttt cacaacgcct       120
     gctgcgagtg catcggtcca gagtgcattg actatgggag taaaactgtc aagtgtatga       180
     actgcatgtt ttaaagaggg ggaagaaatg caaaccaaag cagtaagtca tgaagtgtgc       240
     agaaatcttg gttctggtat gctaggagtg tgttaagtta tatgattgta actgtgcttt       300
     ttatatctgg tgcctattag tgtaggtctt ttccattgga ttcaatggaa ctttagtcac       360
     atgaggatcg ggagttcaga ggagtcctgg gaaaacctga catgctgaca gaaggtgccg       420
     tcttcttcca gctttccaaa cacttctcgt tttgaacgtg atagcacaag cctggtacat       480
     gtgtggttct cacctgccag ttgtagaaca ctaagtccct atagtcacac atctcttaat       540
     tgtgccttgg ctggcttacc tgttttgtat gagtaaatat tacagtttat aattctaaca       600
     actcacattc aagccatgct gaaacttaat ttcaaaccac tttacattgg ttttagaaag       660
     taaatattta ctatatttta caacagaaga gttttgccta gggccagcga gctgactcag       720
     tggataaagg cgcttgctac caagcctgat aacctgagtt ccatccccag agcccgtaca       780
     gtggaaggac aggaccagct gctgggagtt gtcctctgac ctccagacag gcacagtatc       840
     atgcgtggag gtgtgcttgt gtgtgcacac acataactaa ctgtttttaa aaatataaac       900
     ctcttacatg gtgaaatcta aatctgtcgt gtagctctca cactgacagt ggtttggatg       960
     ttatgtcccc tgtccgcctg tagtgctggt gtggtgagac acagagtcgt cactgctctg      1020
     gtatagaaga gttttgtcta ccaagagtgt catggcatac ctttggaact tcatcaaatg      1080
     cacttgagga tgacctgggt caggaagtag ccaggtaaaa gcagcgggac tgtaggcgat      1140
     gctccattag actccgtgca gagcagcagg tgcacagcat agctgggtgt gcggctgacc      1200
     aggagagggt ctgactccgc accagcagaa cagcagggtc tccagcacgt gtgggaagca      1260
     cgtgggagag ggttgaggaa ggatgcacag atgtggacag agaagcataa aaatgtcggg      1320
     aactcctagt agggtccacc ttaaaatcgc tttatagtct ctggctttgt tactctgtaa      1380
     gattacactt gtttctggat atctgaatcc aaataagcat catattttaa gaagctctgt      1440
     ttctgaactt ccagggggaa atctgtttaa tgtgtttact cctagcatac tacagaattt      1500
     tctagctcta tagcttctta cctagcgttt ccatagtgct gagcttcatt actacacgcc      1560
     cttcctagta ataaaattct caccttcaag catgaatcaa aaacaaatat ctataataca      1620
     caggttcaat tttatagaat tgctattttc tctagtgcat atctcattaa aagtaacttt      1680
     ttagg                                                                  1685
//