spacer

EBI Dbfetch

ID   AK017578; SV 1; linear; mRNA; HTC; MUS; 1369 BP.
XX
AC   AK017578;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 8 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:5730419M14 product:neurexin I, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1369
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; af2d466af85ccc0764e772ae75a7fe98.
DR   Ensembl-Gn; ENSMUSG00000024109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160844; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=5730419M14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1369
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="8 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="5730419M14"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1172
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="neurexin I (MGD|MGI:1096391 GB|AJ006802, evidence:
FT                   BLASTN, 100%, match=129)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q9CS84"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR029824"
FT                   /db_xref="MGI:MGI:1096391"
FT                   /db_xref="PDB:3BOD"
FT                   /db_xref="PDB:3MW2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CS84"
FT                   /protein_id="BAB30815.1"
FT                   /translation="CNDPGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEA
FT                   VLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGG
FT                   NATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAT
FT                   IIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEVPSSMTTESTA
FT                   TAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDDILVASAECPSDDEDIDPCE
FT                   PSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNR
FT                   DEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKNKDKEYYV"
XX
SQ   Sequence 1369 BP; 417 A; 322 C; 342 G; 288 T; 0 other;
     tctgcaatga ccctgggaca acatatatct ttagcaaagg tggtggacag attacatata        60
     agtggcctcc caatgaccgc cccagtacac gagcagacag gctggccatc ggatttagca       120
     ctgtccagaa ggaagccgtg ttggtgcgtg tggacagttc ctcaggactg ggtgactacc       180
     tggagctgca catacaccaa ggaaaaattg gagttaagtt taatgttggg acagatgaca       240
     tcgccatcga agagtctaat gcaatcatta atgatgggaa ataccatgta gtacgtttca       300
     caaggagtgg tggcaatgcc acgttacagg tggacagctg gccagttatc gaacgctacc       360
     ctgcaggaaa caatgataac gagcgcctgg cgattgctag acagcgaatt ccatatcgac       420
     ttggtcgagt agttgatgaa tggctactcg acaaagggcg tcagctcaca atcttcaata       480
     gccaagcaac cataataatt ggcgggaaag agcagggcca gcccttccag ggccagctct       540
     ctggtcttta ctacaatggc ttgaaagttc tgaatatggc agcagagaac gatgccaaca       600
     tcgccatagt ggggaatgtg aggctggtcg gtgaagtgcc ttcctctatg acaactgagt       660
     cgacagccac tgccatgcag tctgagatgt ccacctcaat catggagacc accacaaccc       720
     tggctaccag cacagctaga agaggcaagc cccccacaaa ggaacccatc agccagacca       780
     cagatgacat ccttgtggcc tcggcagagt gtcccagtga cgatgaggac attgacccct       840
     gtgagccgag ctcaggtggg ttagccaacc ccaccagagt aggtggccgt gaaccatacc       900
     caggctctgc agaggtgatt cgggagtcca gcagtaccac tggcatggtg gtggggattg       960
     tcgcagcagc cgctctgtgc atcctcatcc tcctctatgc catgtacaag tacaggaacc      1020
     gggatgaagg gtcgtaccac gtggatgaga gtcgaaacta catcagtaac tcagcacagt      1080
     ccaatggggc tgtggtcaag gagaagcaac ccagcagtgc taaaagcgcc aacaaaaaca      1140
     agaaaaacaa ggataaggag tattacgtct gatatcaaga tttgaaacgg acacttgtat      1200
     agaaatagtc ttcattttat ctgagacata atataaactt ttactttcct ttttatgaag      1260
     cacatacaaa agaagacagg gaatgcgatc aggagggaaa actcttttta aaaaaaaaaa      1320
     caaacaagta tctcatgctc ttgtttctca aaagaaaaaa aaaacatac                  1369
//


spacer
spacer