spacer

EBI Dbfetch

ID   AK015337; SV 1; linear; mRNA; HTC; MUS; 1713 BP.
XX
AC   AK015337;
XX
DT   09-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:4930438I19 product:transforming growth factor, beta receptor I, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1713
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3ab04fcd84116c0a9517c0f6c0b3257e.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107725; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=4930438I19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1713
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="4930438I19"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             193..1455
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transforming growth factor, beta receptor I
FT                   (MGD|MGI:98728 GB|NM_009370, evidence: BLASTN, 100%,
FT                   match=1441)"
FT                   /db_xref="GOA:Q9D5H8"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D5H8"
FT                   /protein_id="BAB29802.1"
FT                   /translation="MDLKSLIMVMMEDYKDITPLKKLQENKGPFSEKQSAGLGPVELAA
FT                   VIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTS
FT                   GSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREA
FT                   EIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKL
FT                   ALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDT
FT                   IDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGIHED
FT                   YQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAAR
FT                   LTALRIKKTLSQLSQQEGIKM"
XX
SQ   Sequence 1713 BP; 509 A; 341 C; 409 G; 454 T; 0 other;
     aagttctgac ttaactggga ttacaggaag gacaggctcc aatgagaggg aagggagcac        60
     ttgagataat cagatggcgg aggcaatcat aagaacagaa acaacagaaa ccaaggttac       120
     ttggcatcat cagaacccaa ttctcccacc acagcaagtc ctggatacac catcacacca       180
     gaaaagcaag atatggatct aaagtcactt atcatggtga tgatggaaga ctataaggat       240
     ataactccct taaagaaatt acaggagaat aaaggacctt tttcagaaaa gcagtcagct       300
     ggccttggtc ctgtggagct ggcagctgtc attgctggtc cagtctgctt cgtctgcatt       360
     gcacttatgc tgatggtcta tatctgccat aaccgcactg tcattcacca ccgtgtgcca       420
     aatgaagagg atccatcact agatcgccct ttcatttcag agggcaccac cttaaaagat       480
     ttaatttatg atatgacaac atcagggtct ggatcaggtt taccactgct tgttcaaaga       540
     acaattgcca ggaccattgt gttacaagaa agcattggca aaggtcggtt tggagaagtt       600
     tggcgaggca aatggcgggg agaagaagtt gctgtgaaga tattctcttc tagagaagag       660
     cgttcatggt tccgagaggc agagatttat cagactgtaa tgttacgcca tgaaaatatc       720
     ctgggattta tagcagcaga caacaaagac aatgggacat ggacgcagct gtggttggtg       780
     tcagattatc atgagcatgg atcccttttc gattacttga atagatacac tgttactgtg       840
     gaaggaatga tcaagcttgc tctgtccaca gcaagtggtc ttgcccatct tcacatggag       900
     attgttggta cccaaggaaa accagctatt gcccatagag atttgaaatc aaagaatatc       960
     ttggtgaaga aaaatggaac ctgttgtatt gcagacttgg gacttgctgt gagacatgat      1020
     tctgccacag atacaattga tattgctcca aaccacagag taggcactaa aaggtacatg      1080
     gcccctgaag ttctagatga ttccataaat atgaaacatt ttgaatcctt caaacgcgct      1140
     gacatctatg caatgggctt agtgttctgg gaaattgctc gacgctgttc tattggtgga      1200
     atccatgaag actatcagtt gccttattat gatcttgtac cttctgatcc atcggttgaa      1260
     gaaatgagaa aagtagtttg cgaacagaag ttaaggccaa atattccaaa cagatggcag      1320
     agctgtgagg ccttgagagt gatggctaaa attatgagag aatgctggta tgccaatgga      1380
     gcagcaaggc tgacagcttt gcgaattaaa aaaacattgt cacaactcag ccaacaggaa      1440
     ggcatcaaaa tgtaactgaa acaccgtggg aactctgctc tcttcatatc tgctcctggg      1500
     tgtttaggag gctggttgtt ctacctcact gagagaacag agggctctgc ttcctcttgc      1560
     agcagtggaa tatggtcaac tgaaagcttc ccagggtttc tctgggccca gaggcagccg      1620
     tggggtcctt tctgtgcact atggatactt cttccagaca gttacagaat gttgtgtagt      1680
     ctacttttgt ttttattaac aaagcttgtt ttt                                   1713
//


spacer
spacer