Dbfetch

ID   AK014297; SV 1; linear; mRNA; HTC; MUS; 1340 BP.
XX
AC   AK014297;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 14, 17 days embryo head cDNA, RIKEN full-length enriched
DE   library, clone:3200002B17 product:interleukin-four induced gene 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1340
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f594bb1a753cd2546c44bb141814bce2.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3200002B17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1340
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="14, 17 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3200002B17"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             46..1314
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="interleukin-four induced gene 1 (MGD|MGI:109552)"
FT                   /note="putative"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="BAB29253.1"
FT                   /translation="MSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSL
FT                   SGALLLNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTR
FT                   KRQEALRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLAS
FT                   YTWSDAAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVV
FT                   QPPLYGREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVD
FT                   PQMMEHAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVE
FT                   AIPELQGHVFVETVPQEKGHAHQNIYLRSMYRCMGKSSLSGMVMGDLAPRKCTEWGTTP
FT                   NRKEEVSTQLLSQPSSGQTDHLH"
FT   regulatory      1323..1328
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1340
FT                   /note="putative"
XX
SQ   Sequence 1340 BP; 266 A; 399 C; 427 G; 248 T; 0 other;
     gagggcaacc tgtcccggcc ggctgtgcag ctcctgggag atgtgatgtc cgaggagggc        60
     ttcttctacc tcagctttgc agaagcctta cgtgcgcacg cctgcctgag cgatagactc       120
     cggtacagcc gcatcgtagg tggctgggac ctgcttccgc gagctctgct gagctcactg       180
     tccggggcgc tgctactgaa cgcgcctgtg gtgtcgatca ctcaggggag gaacgatgtg       240
     cgcgtgcaca ttgccacctc gcttcacagc gagaagacgc tgacagccga cgtggtgctg       300
     ctgactgcca gtggacccgc gctgcagcgc attaccttct cgccgccctt gactcgcaag       360
     aggcaggagg cactgcgcgc gcttcactac gtagcagcca gcaaggtttt tctgagtttc       420
     cgtcggccct tctggcacga ggagcacatc gagggcggcc actccaacac tgaccgccca       480
     tcgcgcctca tattctatcc cgcgcagggc gagggctcac tgcttctggc ctcctacacg       540
     tggtcggacg ctgcagcccc cttcgctgga ctgagcaccg accagaccct gcgtttggtg       600
     ctccaggacg tggcggccct gcacgggcct gtggtgttcc ggctgtggga cggcaggggt       660
     gtggtcaagc gctgggcaga ggacccgcat agccagggag gcttcgtggt gcagccgcca       720
     ttgtacgggc gcgaggctga ggactatgac tggtcagccc ccttcggccg catttacttc       780
     gcgggcgagc acacagctct cccgcatggc tgggtagaga ccgctgtcaa gtccgggttg       840
     cgggccgcgg tgagaatcaa taataactat gggtacgggg aggtcgaccc ccagatgatg       900
     gagcatgcat atgcagaggc caactatctg gaccagtatc ctgaagggga gaggcccgag       960
     gagcagcagg cgcgggaaga agtcagccca gatgaacagg agccctctca caaacacttg      1020
     ttggtggaaa cgagccccga ggggcagcaa cacgcgtttg tggaggccat tcccgagctg      1080
     cagggacacg tgttcgtgga gactgtcccc caggagaagg ggcacgccca ccagaatata      1140
     tatcttcgga gcatgtacag gtgcatgggg aagtcatccc tgagtggcat ggtcatgggg      1200
     gatctggcac cccgcaaatg caccgagtgg gggaccactc ctaatcgcaa ggaggaagtg      1260
     agcacccagc tcctaagcca gccctcttca gggcagacag accacctaca ctaatagccc      1320
     acaataaagt tatttttgtt                                                  1340
//