spacer

EBI Dbfetch

ID   AK013940; SV 1; linear; mRNA; HTC; MUS; 2780 BP.
XX
AC   AK013940;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 13 days embryo head cDNA, RIKEN full-length enriched library,
DE   clone:3110001D23 product:insulin-like growth factor 2, binding protein 1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2780
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000013415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013559; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=3110001D23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2780
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="13 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="3110001D23"
FT                   /tissue_type="head"
FT                   /db_xref="taxon:10090"
FT   CDS             279..2012
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="insulin-like growth factor 2, binding protein 1
FT                   (MGD|MGI:1890357)"
FT                   /note="putative"
FT                   /db_xref="GOA:O88477"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1890357"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88477"
FT                   /protein_id="BAB29071.1"
FT                   /translation="MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCP
FT                   DEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQY
FT                   GTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGP
FT                   ENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKI
FT                   LAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAE
FT                   QEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSF
FT                   MQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVVITG
FT                   PPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLT
FT                   AAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNLAQARR
FT                   K"
XX
SQ   Sequence 2780 BP; 691 A; 787 C; 752 G; 550 T; 0 other;
     ggtttcggac cgaaggaagg agccgcgccg cgtcgtcgtc agcctcccct gcactcggcg        60
     ggcacttctc ccgggctcac ccaaactctc ccgtgacccc cgcgtgccct caggccgccc       120
     acccgcccgg agctccggac aacttcaggg gtggggtgcg tagaaagttt gcggctcccg       180
     ccgcccgtct ccacgcctct cggcctagga ggctctccgc ccgcgcccgc ccggctcggc       240
     cttgcctgga accgtgtcct tgccccgcca ccgccaccat gaacaagctt tacatcggca       300
     acctcaacga gagtgtgacc cccgcagact tggagaaagt attcgcggag cacaagatct       360
     cctacagcgg ccagttcttg gtcaaatccg gctacgcctt cgtggattgc cccgacgagc       420
     actgggcgat gaaggccatc gaaactttct cggggaaagt agaactgcaa ggaaaacgtc       480
     tagagattga acactcagtc cccaaaaaac aaaggagtcg gaaaatacag attcgcaata       540
     ttccacctca gctccgatgg gaagtgctag atagcctgct ggctcagtac ggtacagtgg       600
     agaactgtga gcaagtgaac actgaaagtg agacagctgt ggtcaacgtc acctactcta       660
     accgggagca gaccaggcaa gctatcatga agctaaatgg ccatcaactg gagaaccatg       720
     ccctgaaggt ctcctacata cctgatgagc agataacgca aggtcctgag aatgggcgtc       780
     gtggaggctt tgggtctcgg ggccagcccc ggcaagggtc gcccgtggca gcaggggctc       840
     cagccaagca gcagccagtg gacatccctc tccggctcct ggtgcctacg cagtatgtag       900
     gcgctatcat tggcaaggag ggtgccacca tccgaaacat cacaaaacag acgcagtcca       960
     aaatagacgt gcataggaag gagaatgcgg gcgctgcgga gaaggccatc agcgtgcatt      1020
     caacccctga aggctgctcc tccgcgtgca agatgatctt ggagattatg cacaaggagg      1080
     caaaggacac caaaacggca gatgaagttc ccctgaagat cctggctcat aacaacttcg      1140
     tcgggcgact cattggcaag gaagggcgga acctgaagaa ggtggagcag gacacagaga      1200
     cgaagatcac catctcatcg ctccaggacc tcacgctcta taaccctgag aggaccatca      1260
     ctgtgaaggg cgccattgag aactgttgca gggccgagca ggagatcatg aagaaagttc      1320
     gagaggctta cgagaacgac gtggccgcca tgagcttgca gtcccacctc atccctgggc      1380
     ttaacctggc tgctgtaggt ctcttcccag cttcatccag cgctgtccct cctcctccca      1440
     gcagtgtcac cggggctgct ccctatagct ccttcatgca ggctccggag caggagatgg      1500
     tacaagtgtt catccccgcc caggctgtgg gcgccatcat tggcaagaag ggccagcaca      1560
     tcaaacaact ctcccgcttc gccagcgcct ccatcaagat tgcaccacca gaaacacctg      1620
     actccaaagt tcgaatggtc gtcatcactg gacccccaga ggctcagttc aaggcccagg      1680
     gaagaatcta tggcaaacta aaagaagaga atttctttgg tcccaaggag gaagtaaagc      1740
     tagagaccca catacgggtt ccggcttcag cagccggccg tgtcatcggc aaaggcggca      1800
     aaacggtgaa tgagctgcag aacttgaccg cagctgaggt ggtagtgcca agagaccaga      1860
     ccccggatga gaacgaccaa gtcattgtta agatcatcgg acatttctat gccagccaga      1920
     tggctcagcg gaagatccga gacatcctgg ctcaagttaa gcaacagcac cagaagggac      1980
     agagcaacct ggcccaggct cggaggaagt gaccccgccc cctcctgtcc cattggctcc      2040
     aagatcagca ggaggaacac agaactggag gggcgggtgg agggccggtg tgctcttccc      2100
     agcaggcctg agaatgagtg ggaatcaggg catttgggcc tggctggaga tcaggtttgc      2160
     acactgtctt gagaacaatg ttccagtgag gaatcctgat ctctcgcccc caattgagcc      2220
     agctggccac agcccacccc ttggaatatc accattgcaa tcatagcttg ggttgctttt      2280
     aaacgtggat tgtcttgaag ttctccagcc tccatggaag gatgggtcag atcccagtgg      2340
     ggaagagaaa taaaatttcc ttcaggtttt ataaaacctc aaaggatggt ttgtttctta      2400
     acccctccaa atctttctaa ccttcttggt taattcacga aaattcctcc cgttcttaat      2460
     gtcctgacca gtaacttacc tcttcctgga tccattcaca ctgtttcagc cttgttgtgc      2520
     tggggtgggg gaggggcggg aggagggcta gaacacagct ttgtttacaa tattaactct      2580
     ggagagccct atcctggata gtctaattct gatttttcct taaccaacca ttaggaacag      2640
     caagatataa aggagagagt taataattac agtatgtacc gatccacgtt taaagggagt      2700
     ccttgggcta aggatagagc tcgccgggca cagtgcttgc ccggcacgga cgaggccctg      2760
     gcttctatcc ttggcatcac                                                  2780
//


spacer
spacer