Dbfetch

ID   AK013729; SV 1; linear; mRNA; HTC; MUS; 1023 BP.
XX
AC   AK013729;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:2900059O22 product:ubiquitin carboxy-terminal hydrolase L1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1023
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0db3deb6419a83e384699666ba5dbd9b.
DR   Ensembl-Gn; ENSMUSG00000029223; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029590; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029558; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029506; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029567; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029290; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0030021; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029259; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029490; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029393; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0030054; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028422; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028778; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000031131; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0072010; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071923; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071581; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0072414; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0072123; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071674; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071595; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070733; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2900059O22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1023
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2900059O22"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             50..721
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="ubiquitin carboxy-terminal hydrolase L1
FT                   (MGD|MGI:103149 GB|NM_011670, evidence: BLASTN, 99%,
FT                   match=975)"
FT                   /db_xref="GOA:Q9R0P9"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="InterPro:IPR030297"
FT                   /db_xref="MGI:MGI:103149"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R0P9"
FT                   /protein_id="BAB28976.1"
FT                   /translation="MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSP
FT                   ACALLLLFPLTAQHENFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQD
FT                   KLEFEDGSVLKQFLSETEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFI
FT                   LFNNVDGHLYELDGRMPFPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKA
FT                   A"
FT   regulatory      1001..1006
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1023
FT                   /note="putative"
XX
SQ   Sequence 1023 BP; 218 A; 286 C; 289 G; 230 T; 0 other;
     cggttttttc ggtctctcgg gtttgtgtct gcaggtgcca tccgcgaaga tgcagctgaa        60
     gccgatggag attaaccccg agatgctgaa caaagtgttg gccaagctgg gggtcgccgg       120
     ccagtggcgc ttcgccgacg tgctagggct ggaggaggag actctgggct cagtgccatc       180
     ccctgcctgc gccctgctgc tcctgtttcc cctcacggcc cagcatgaaa acttcaggaa       240
     aaagcaaatt gaggaactga agggacagga agttagccct aaagtttact tcatgaagca       300
     gaccatcgga aactcctgtg gtaccatcgg gttgatccac gcagtggcca acaaccaaga       360
     caagctggaa tttgaggatg gatccgtcct gaaacagttt ctgtctgaaa cggagaagct       420
     gtcccccgaa gatagagcca agtgtttcga gaagaacgag gccatccagg cggcccatga       480
     ctccgtggcc caggagggcc agtgtcgggt agatgacaaa gtgaatttcc attttattct       540
     gttcaacaac gtggacggcc atctgtacga gctcgatggg cgaatgccct ttccagtgaa       600
     ccatggcgcc agctcagagg actctctgct gcaggatgct gccaaggtct gcagagaatt       660
     cactgagcgc gagcaggggg aggtccgctt ctctgccgtg gctctctgca aagcagctta       720
     agtctgggga gagagaacca gccgatcccc ccttccctgg gcaggtgcgc gcggcccgcc       780
     cttggtttgc agctttagca cttagaacca cagctgtctt cttgcgttct acagccccat       840
     cccctccacc ccacccaggc caccaggggg ctctgtcaca gccacaccag gctgagcact       900
     ttccctcctg tgtgtctcgt accttgctct ctacggtctc tttggtttct gtctgtaagt       960
     tacggccctg gatgtggttt gtctagtcct taagaggaag aataaaactt tgctggtgag      1020
     agc                                                                    1023
//