spacer

EBI Dbfetch

ID   AK013727; SV 1; linear; mRNA; HTC; MUS; 2475 BP.
XX
AC   AK013727;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:2900059A15 product:gamma-aminobutyric acid (GABA-A)
DE   receptor, subunit alpha 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2475
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 265cca72c24bac09b15fed0d5002042b.
DR   Ensembl-Gn; ENSMUSG00000029211; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031121; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2900059A15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2475
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2900059A15"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             501..2159
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid (GABA-A) receptor, subunit
FT                   alpha 4 (MGD|MGI:95616, evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D6F4"
FT                   /db_xref="InterPro:IPR001390"
FT                   /db_xref="InterPro:IPR005434"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6F4"
FT                   /protein_id="BAB28975.1"
FT                   /translation="MVSVQKVPAIALCSGVSLALLHFLCLAACLNESPGQNSKDEKLCP
FT                   ENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWI
FT                   DKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYT
FT                   MRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLV
FT                   QYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWIN
FT                   KESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAV
FT                   NYFTNIQMQKAKKKISKPPPEVPAAPVLKEKHTETSLQNTHANLNMRKRTNALVHSESD
FT                   VKSRTEVGNHSSKTSAVQESSEATPKAHLASSPNPFSRANAAETMSAAARGLSSAASPS
FT                   PHGTLRPASLGSASTRPAFGSRLGRIKTTVNTTGAAGNVSATPPPPAPPPSGSGTSKID
FT                   KYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLM"
XX
SQ   Sequence 2475 BP; 678 A; 565 C; 607 G; 625 T; 0 other;
     gattgtttcc agccaaaccc tggtaaaggg agggagaaaa gcagaaagaa gagaagtcag        60
     cccaggccag tggcagggga cccaattggg gttttgaagt cgctgacccg gagcagggac       120
     caaggaccgt gggtggcgtc ccctgagtta caggttggaa caaacttgcc tagcttcgag       180
     tggcaggagc tcccaagttc accggtgagc agcacttgca agcttgacaa ggtgcggagc       240
     tgagcgccgg gctctcgctc gcactgggcg cgagcggcga gggagggggc gggcgcgcag       300
     gtcccgcctc ccctggccgc gtgcacacac acgcccaccg cggctaggct ggaggagcgc       360
     gggcgagtgt gagcgcgggc gagtgtgagc gcgagtgtgc gcacgccgcg ggagccactc       420
     tgccctctcc tcgcaccctg cccagggcat ctcgagaggc tggaaacgtg aacaggctta       480
     aagtatggca tgttgcgaag atggtttctg tccagaaggt acccgcgatt gcgctgtgct       540
     ccggggtcag cctcgccctc ctgcacttcc tgtgcctggc ggcttgttta aacgaatccc       600
     caggacagaa ctcaaaggac gagaaattgt gcccggaaaa ttttacccgt attctggaca       660
     gtttgctgga tggttatgac aacaggctgc gtcctggatt tgggggtcct gttacagaag       720
     tgaaaactga tatatatgtc accagctttg ggcccgtttc tgatgttgaa atggaataca       780
     ctatggatgt gttcttcaga cagacatgga ttgacaaaag actaaaatat gacggcccaa       840
     ttgaaatctt gaggctgaat aatatgatgg tcaccaaagt ttggacccct gatactttct       900
     tcaggaatgg aaagaaatct gtctcacata acatgacagc tccaaataag ctttttagaa       960
     ttatgagaaa tggcactatt ttatacacaa tgagactcac cataagtgcg gagtgcccca      1020
     tgagactggt ggattttcct atggatggtc atgcctgccc tttgaaattt gggagttatg      1080
     catatcccaa aagtgagatg atctacacct ggaccaaagg ccctgagaag tcagtggagg      1140
     tgccaaagga gtcttctagc ttagttcaat atgacctcat tgggcagact gtatcaagcg      1200
     agactatcaa atctattaca ggtgaataca ttgttatgac ggtttacttc cacctcagac      1260
     ggaagatggg ctactttatg attcagacgt atatcccatg catcatgaca gtgattcttt      1320
     ctcaagtttc cttctggata aacaaggagt ctgttccagc tagaactgta tttggaataa      1380
     ccacagtcct cacgatgacc accctaagca tcagtgctcg gcattctttg cccaaagtgt      1440
     cctatgcgac tgccatggat tggttcatag ctgtctgttt tgcttttgta ttttcggctc      1500
     ttattgagtt tgctgctgtc aactatttca ccaacattca aatgcagaaa gccaaaaaga      1560
     agatatcaaa gcctccccca gaagttccag ctgctcctgt gctgaaggag aaacacacag      1620
     aaacatccct tcagaataca catgccaatt tgaacatgag gaaaagaaca aatgccttgg      1680
     tccattcaga atcggatgtc aaaagcagaa ctgaggtggg aaatcactcc agcaagacca      1740
     gcgctgtcca ggagtcttct gaagccacgc ctaaggctca cttagcttcc agtccaaatc      1800
     cattcagcag ggcaaatgca gctgagacta tgtctgctgc agccagaggt ctttcatctg      1860
     cagcatcccc ctctccgcat ggcacattgc ggccagcttc tttggggtca gcttccactc      1920
     gccctgcatt tggatctaga cttgggcgaa ttaagacaac agttaataca acaggggctg      1980
     ctgggaatgt gtcagccaca cctcctcccc ctgctccacc gccttctgga tctggcacaa      2040
     gtaaaataga caaatatgct cgtattctct ttccagtcac atttggagca tttaacatgg      2100
     tctactgggt tgtttattta tctaaggaca ccatggagaa atcagaaagt ctaatgtaat      2160
     tttgttgcta tagtaatttc ataacaacga tggaaataca gactgtcttt taaaatgttt      2220
     ttaaaggtaa gtattcttta ctaaaataaa aattctatgt aattttttca cttaaaaaaa      2280
     tacaagtcag atatggagag agttaattaa ctcttcagtg gctagaaagt gaaccatctt      2340
     tctttataga aagatagctt taaaagaatc tattcagtgt tcaaattgga tagaacacag      2400
     agcattatgg aaagttggag caagagaaat agagctagga gagatatgtg gtacaccctt      2460
     ttgcattgaa atttg                                                       2475
//


spacer
spacer