Dbfetch

ID   AK013607; SV 1; linear; mRNA; HTC; MUS; 1313 BP.
XX
AC   AK013607;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:2900029D21 product:SNRPN upstream reading frame, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1313
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f6ed1cc004600c0faf7404c2b37d6aac.
DR   Ensembl-Gn; ENSMUSG00000102252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2900029D21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1313
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2900029D21"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             467..1189
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="SNRPN upstream reading frame (MGD|MGI:1891236,
FT                   evidence: Direct assignment)"
FT                   /note="putative"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="BAB28927.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
XX
SQ   Sequence 1313 BP; 339 A; 335 C; 339 G; 300 T; 0 other;
     tggcagagag gagagggagc cggagatgcc agacgcctgg ttctgaggag tgatttgcaa        60
     cgcaatggag cgaggaaggg atcgcttaca cttgagaaga actactgaac agcacgtgcc       120
     cgaggtcgag gtccaggtca aacgtcgaag gacagcctca ctgagcaacc aagagtgtca       180
     cttgtaccca cgacgttctc agcaacagca agttcctgtg gtggatttcc aggcagaact       240
     aagacaggca ttcttagctg agacaccaag aggtggttaa agcagtattg caacttcaag       300
     gtggtggaat tcaaggaaaa caggacccat cctctgtctg tgaaactttg gtcaagctta       360
     cattgtttgt taatagcctg catcgaacct ttatttatat cccttccccg agtattaagg       420
     atcttgaaat tttagtgttg acaacggcta ttgtggaaca gcaatcatga ctgtgggtaa       480
     gagtagcaag atgctgcagc acattgacta taggatgaga tgtatcctgc aagatgggag       540
     aatcttcatt ggcaccttca aggcttttga caagcatatg aatttgatcc tctgtgattg       600
     tgatgagttc aggaagatca agccaaagaa tgcaaaacag ccagaacgtg aagaaaaacg       660
     ggttttgggt ctggtcttgc tacgtgggga gaacttggtt tcaatgactg tggagggccc       720
     acctcctaaa gatactggca ttgctcgtgt gcctcttgct ggcgctgcag gtggccctgg       780
     ggttggaaga gcagctggca gaggagtgcc agcaggtgta cctattcccc aggctcctgc       840
     tggattagca ggccctgtca gaggagttgg aggcccatcc cagcaggtca tgaccccaca       900
     gggaagaggc actgttgcag ctgctgctgt tgctgctact gctagcattg caggagcccc       960
     aacccagtac ccgccaggac ggggaactcc acctccacct gtaggcagag caaccccacc      1020
     tccaggcatt atggctcctc cacctggtat gagaccaccc atgggcccac ccattgggct      1080
     tccccctgct cgtgggacac ctataggcat gcctcctcca ggaatgagac cccctccacc      1140
     aggaattaga ggcccacctc ccccaggaat gcgcccacca agaccctaag atacagttga      1200
     taaatctcag cccttctctt cccctacaat gcttcttgtg aaattgtgta cctgcaagct      1260
     ttttgacccc tcttactgca ttaactatag ataataaata catagagcaa tcc             1313
//