Dbfetch

ID   AK013476; SV 1; linear; mRNA; HTC; MUS; 2050 BP.
XX
AC   AK013476;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male hippocampus cDNA, RIKEN full-length enriched
DE   library, clone:2900002L20 product:NEURAL MEMBRANE PROTEIN 35 homolog
DE   [Rattus norvegicus], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2050
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 64910c7671464666c31d520f890dda9c.
DR   Ensembl-Gn; ENSMUSG00000023011; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022291; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022297; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022065; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022742; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021590; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022034; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022161; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022141; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022232; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022161; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022757; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021328; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021640; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000023750; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042551; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042511; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042477; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042504; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042238; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042988; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042338; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042149; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042272; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042373; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042248; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043031; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041921; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041632; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2900002L20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2050
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2900002L20"
FT                   /tissue_type="hippocampus"
FT                   /db_xref="taxon:10090"
FT   CDS             11..928
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="NEURAL MEMBRANE PROTEIN 35 homolog [Rattus
FT                   norvegicus] (SPTR|O88407, evidence: FASTY, 93.4%ID,
FT                   100%length, match=915)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8K097"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1919643"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K097"
FT                   /protein_id="BAB28874.1"
FT                   /translation="MTQGKLSVANKAPGTEGQQHQANGEKKDAPAVPSAPPSYEEATSG
FT                   EGLKAGTFPQGPTAVPLHPSWAYVDPRHHEHFTTFSWDDQKVRRLFIRKVYTILLVQLL
FT                   VTLAVVALFTFCDVVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTI
FT                   FTLSMAYLTGMLSSYYNTTSVLLCLVITALVCLSVTIFSFQTKFDFTSCQGVLFVLLMT
FT                   LFFSGLLLAVLLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGNRRHSLSPEEYIFG
FT                   ALNIYLDIIYIFTFFLQLFGTNRE"
XX
SQ   Sequence 2050 BP; 399 A; 644 C; 519 G; 488 T; 0 other;
     agaagacatc atgacccagg gaaagctctc tgtggctaac aaggcccccg ggactgaggg        60
     gcagcagcac caggcaaatg gagagaagaa ggatgctccg gcagtgccct cggcgccacc       120
     ctcctatgag gaggccacct ctggagaggg gctgaaggca gggaccttcc cccagggccc       180
     aacagctgtg ccactccatc caagctgggc ctacgtggac cccagacatc acgagcattt       240
     caccaccttc agctgggatg accagaaagt tcgtcggctc ttcatcagaa aggtctatac       300
     catcctattg gtccagctgc tggtgacctt ggctgtggtg gctctcttta ccttctgtga       360
     tgtcgttaag gactatgtcc aggctaaccc cggctggtac tgggcgtcct atgccgtgtt       420
     ctttgcaact tacctgactc tggcttgctg ttctggaccc aggagacatt tcccttggaa       480
     cctgattctg ctgaccatct ttaccctgtc catggcctac ctcactggga tgctgtccag       540
     ttactacaac accacatctg tgctgctgtg cctggtcatc acggctctcg tctgcctctc       600
     ggtcaccatc ttcagtttcc agaccaagtt tgacttcacc tcctgtcagg gtgtgctgtt       660
     tgtgctgctc atgaccctct tcttcagtgg actcctcctc gctgtcctcc tgcccttcca       720
     atacgtcccc tggctccacg cggtctatgc tgtactggga gcgggtgtgt tcacgttgtt       780
     cctggccttt gatacccagt tgctgatggg taaccgtcga cactcgctga gccccgagga       840
     gtatattttt ggagccctca acatctactt agacattatc tatatcttca ccttcttcct       900
     gcagcttttt ggcaccaacc gggaatgagg agccatcccc gcccccaccc ctcctccaga       960
     gaatgtccct tccctgtcct gtgaccctct ccgtgctcct gtgagaccag acataaactc      1020
     gctgcagcca gcttgtgagc agccgcttgc tccctcctgc agccagccct cacggtgtcc      1080
     ttctgcagct tgtacatatg ccatgcttgg ggccctgcag atctgaggcc ataccatccc      1140
     ctgcggtgcc cctggcaccc aactgcatct tccaaatggc acagtcaagg ctgagggcac      1200
     ctctgggttt gcagacccaa ggaatgagca ggaggagccc ggcaggatct cagaggtggg      1260
     gaggagaccc caggaaacct ggctgtgact gtgaccccca ccaagtcttc tagggctcca      1320
     ttttctcttt cagatcaaac aaccatgctt cgtaagaaaa aaatagccaa gggggcatgg      1380
     ctagagcatg aagtcagggc tctgtggcgt agggtgaagc tgtccccagc tgtcactcgc      1440
     ttagctgaag gccagttgct tgttctaggg acctgggaat agaatgagaa taggaagcca      1500
     ctggtttcgt tacttgcctc agtttcccct cctgggtctt cccctgtatt ctgctgcact      1560
     ctgtcttacc tgcagcctga agagtagagg catccatttc cctccgccca gcttccctgg      1620
     ccactcagcc cagagtccct gggcccttgc ccccttatct ccacatctct gtaatttgga      1680
     agctgtccag ctaatggtca cagccagggc cagtcccttg agcctatccc ttgcgatgag      1740
     gccagagctc cttatcaacc tccaggctgc tgggatctca ggcagagtgt gcgtcagcca      1800
     ccctgccctg gctgactgcc tgttggagag gggaccaggg gcccacacct ggggcagcat      1860
     gtgggcgaca catgcacccg gccagctcta gtccagtgga aagttactgg gtgaaggcta      1920
     caaggccctg agtggatgca ggggaccctg tctgccccag gaaaggggac taggtagccc      1980
     atccattccc acccctaccc tttcccaccg tgcctactcc agcctttgag aaatattaca      2040
     gaagcatttt                                                             2050
//