spacer

EBI Dbfetch

ID   AK012847; SV 1; linear; mRNA; HTC; MUS; 1429 BP.
XX
AC   AK012847;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10, 11 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2810031L11 product:hypothetical Uncharacterised protein
DE   family Hly-III/UPF0073 containing protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1429
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; c94707fb38ba7841c07a1477c9140b83.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2810031L11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1429
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10, 11 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2810031L11"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             237..1295
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="hypothetical Uncharacterised protein family
FT                   Hly-III/UPF0073 containing protein (InterPro|IPR004254,
FT                   evidence: InterPro)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91VH1"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VH1"
FT                   /protein_id="BAB28509.1"
FT                   /translation="MSSHKGSPRAQRNGAPSGNREADTVELAELGPPLEEKAKRAASSP
FT                   PNAQEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVCEGRWRVIPYDVLPDWL
FT                   KDNELLLDGHRPPIASSRACFKSIFRIQKETRNICTHRLRFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLAAVLCLSFSCLFHTVYCHSEKVSLTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPGFIYLSIVCVLGISAIIVRQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHF"
XX
SQ   Sequence 1429 BP; 270 A; 427 C; 400 G; 332 T; 0 other;
     gggaggtgac cgcgtgcggt cgcgcggccc ttccggcgcc ggcagggcgc tgaggatcgg        60
     gcgccccccg ccgcagccct cccagtgccg cgggatgtag cggcccggcg cgcggcccca       120
     cgcagaggca gccagccagg cctgtccacc atcccaggaa gatctctgcc ctctggggct       180
     gagagacccc aacctttctt caagccgaag ctgccaggca ctgaggtacc acccagatgt       240
     cttcccacaa aggctctccc cgggcacaac gcaatggggc tccttctggt aacagagaag       300
     ctgacacagt ggagctggct gagctggggc ccccgctgga ggagaaggcg aagcgggcag       360
     cgagcagccc acccaacgct caggaagatc aagcatgccc ggtgcctcag gaagaggagg       420
     aggaggtgcg ggtgctgacg cttcctctcc aagcccacca tgccatggag aagatggagg       480
     agttcgtgta taaggtctgc gagggacgtt ggagagtcat cccgtatgat gtgcttcctg       540
     actggctgaa agataacgag ctactgctag atggccacag accacctatc gcctcctctc       600
     gggcttgctt caagagcatc ttccgcatcc aaaaagaaac tcgcaacatc tgcacacatc       660
     ggcttcgatt tgtgctattt ctctttctgg gaatcttgac gatgctgaga ccaaatatgt       720
     acttcatggc tcccctgcag gagaaggtgg tcttcgggat gttcttcctg gcggcggtgc       780
     tctgcctcag tttctcctgt ctcttccaca ctgtctactg tcattcagag aaggtctctc       840
     tgactttttc caaactggac tattcaggga ttgctctact gattatgggg agcttcgttc       900
     cctggctcta ttactccttc tactgctccc cacagccggg cttcatctac ctctccatcg       960
     tctgtgtcct gggcatctct gccatcattg tgcgacagtg ggaccggttt gccactccca      1020
     agcaccggca gacaagagca ggagtgttcc tgggacttgg cttgagtggt gttgtaccca      1080
     ccatgcactt tactatcgct gagggctttg tcaaggccac cacggtgggc cagatgggct      1140
     ggttcttcct catggctgtg atgtacatca ccggcgccgg cctgtatgct gctcggattc      1200
     ctgagcgctt cttccctgga aaatttgaca tctggttcca gtctcatcag attttccacg      1260
     tcctggtggt ggcagcagct ttcgtccact tctagggtgt gtccaacctt caggaattcc      1320
     gttatggcct agaaggtggc tgtaccgacg actcccttct cgtgagcctc ccgcacctga      1380
     ggggtggagg agggacttcc caagtgcttt taaaaataac ttctttgcc                  1429
//


spacer
spacer