spacer

EBI Dbfetch

ID   AK012578; SV 1; linear; mRNA; HTC; MUS; 614 BP.
XX
AC   AK012578;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 11 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2700088D09 product:S100 calcium binding protein A1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-614
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 150ce15d6031f69f76258bcdd6b02133.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2700088D09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..614
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="11 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2700088D09"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             144..428
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="S100 calcium binding protein A1 (MGD|MGI:1338917)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91V77"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V77"
FT                   /protein_id="BAB28330.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
FT   polyA_signal    591..596
FT                   /note="putative"
FT   polyA_site      614
FT                   /note="putative"
XX
SQ   Sequence 614 BP; 145 A; 160 C; 167 G; 142 T; 0 other;
     ggagccgttg gggaggaggt cggtagggaa agacgactaa aagacaggtc tcctcacacc        60
     ggtccagtgg ccacatttgc agcgtgccct tctgtcgagt atctgttccg acgtcaggcc       120
     gaggccaacc gtgtgctgct gaaatgggct ctgagctgga gagtgccatg gagaccctca       180
     tcaatgtgtt ccatgcccat tcgggcaagg aaggggacaa atataagctg agcaagaaag       240
     aactgaaaga cctgctacaa actgaacttt ctggcttcct ggatgtccag aaggatgcag       300
     atgctgtgga caaggtaatg aaggaactgg atgaaaacgg agatggggaa gtggacttca       360
     aggagtatgt tgtgctggtg gctgctctca cagtggcttg taacaacttc ttctgggaga       420
     ccagttgagc acagtctgtg agcagtgccc ttcctctccc acttgtcaag atttcccctt       480
     tagcgtgctt gctcctcacc ccacctgtac ctccctatgt ccccatcctt gcccagtctc       540
     gacgtgcacc aagggcacaa gagtggcagt ccagatctgc cacttgtttt aataaagcct       600
     tctctctcac cagc                                                         614
//


spacer
spacer