Dbfetch

ID   AK011841; SV 1; linear; mRNA; HTC; MUS; 937 BP.
XX
AC   AK011841;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2610110O09 product:glutathione S-transferase, alpha 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-937
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fb001e0360d1002e7209cec5ec51558a.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2610110O09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..937
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2610110O09"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             99..767
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, alpha 4 (MGD|MGI:1309515
FT                   GB|NM_010357, evidence: BLASTN, 98%, match=762)"
FT                   /note="putative"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="BAB27873.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRSAPPDGPYVEVVRTVLKF
FT                   "
XX
SQ   Sequence 937 BP; 260 A; 203 C; 270 G; 204 T; 0 other;
     ttgctgcagg acggtgaact ttcgctcgca gaaccgcttc tttccagtgc ctggagacaa        60
     caatcccaca agaataagga agctctgaag caggagtcat ggcagccaaa cctaagctct       120
     actactttaa tggcagggga cggatggagt cgatccgctg gctgctggct gcggctggag       180
     tggagtttga ggaagaattt cttgagacaa gggaacagta tgagaagatg caaaaggatg       240
     gacacctgct tttcggccaa gtacccttgg ttgaaatcga tgggatgatg ctgacacaga       300
     ccagggccat cctcagctac ctcgctgcca agtacaactt gtatgggaag gacctgaagg       360
     agagagtcag gattgacatg tatgcagatg gcacccagga cctgatgatg atgattgccg       420
     tggctccatt taaaaccccc aaggaaaaag aggagagcta tgatttgata ctgtcaagag       480
     ctaaaacccg ttacttccca gtgtttgaaa agattttaaa agaccacgga gaggcttttc       540
     tcgttggcaa ccagctcagt tgggcagaca tccagctcct agaagccatt ttgatggtgg       600
     aagaactcag tgcccctgta ctgtccgact tccctctgct gcaggcattt aagacaagaa       660
     tcagcaacat tcctacaatt aagaagttcc tgcaacccgg aagtcagaga agcgctcctc       720
     cagatggccc ctatgttgag gtggtcagga ctgtcctgaa gttctagtgc agcgtgcttt       780
     aaggtgggac ccgagaggtt gggaattgca gtgtgggggg agggggggtg cggagcattc       840
     cagaagcaag gtatataggt gccaggagtg aagctcttga aacaacaaaa ggagtgtcgc       900
     cacaatgaga agtgcggggt gaatacagtg gaaaact                                937
//