spacer

EBI Dbfetch

ID   AK011731; SV 1; linear; mRNA; HTC; MUS; 776 BP.
XX
AC   AK011731;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus 10 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2610041D12 product:gamma-aminobutyric acid receptor
DE   associated protein, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-776
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7156190ed24432b27f51ef2f898cabaa.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2610041D12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..776
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2610041D12"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             9..362
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="gamma-aminobutyric acid receptor associated protein
FT                   (MGD|MGI:1861742)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="BAB27806.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
FT   polyA_signal    759..764
FT                   /note="putative"
FT   polyA_site      776
FT                   /note="putative"
XX
SQ   Sequence 776 BP; 187 A; 197 C; 180 G; 212 T; 0 other;
     tggggagaat gaagttcgtg tacaaagagg agcatccgtt cgagaagcgc cgctctgagg        60
     gcgagaaaat ccgaaagaaa tacccagacc gggtcccggt gatagtggaa aaagccccca       120
     aagctcggat aggagacctg gacaaaaaga aatacctggt gccttctgat cttacagttg       180
     gtcaattcta cttcttgatc cggaagcgaa ttcatctccg tgctgaagat gccttgtttt       240
     tctttgtcaa caatgtcatt ccacccacca gtgccacgat gggtcagctg taccaggaac       300
     accatgaaga agacttcttt ctatacattg cctacagtga tgaaagcgtc tatggtctgt       360
     gaagctgctg tacctgaggt ggggggttcc attctacgaa gagaggtggc gctccttcct       420
     tgacatccag ttcctccttc aggctcaaac accacctcct ttcttcagga cctgcactta       480
     atgtttgagg ctgtctctcc agtccctctc agcaggaggg gtaatggtag atacagcctc       540
     catacatctc tttctcccct tgtttaccct ccattcccac tctgatttag acttcttgat       600
     tgtcgatctc tgtcacatcc gatgattgtt ttggtttcta ttccctttct aactgcccat       660
     cgggctcaga accccaataa tcccttcctt tcactatctt ctttttgggg ggtaggtgga       720
     agggattgac attggatggg ggaggtagga ggcacatcaa taaaaaggaa accacc           776
//


spacer
spacer