spacer

EBI Dbfetch

ID   AK011177; SV 1; linear; mRNA; HTC; MUS; 908 BP.
XX
AC   AK011177;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10 days embryo whole body cDNA, RIKEN full-length enriched
DE   library, clone:2600010C08 product:glutathione S-transferase, alpha 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-908
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e4d3eba161214761cead6658296e0ce0.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2600010C08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..908
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="10 days embryo"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2600010C08"
FT                   /tissue_type="whole body"
FT                   /db_xref="taxon:10090"
FT   CDS             71..739
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, alpha 4 (MGD|MGI:1309515
FT                   GB|NM_010357, evidence: BLASTN, 99%, match=905)"
FT                   /note="putative"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="BAB27449.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
FT                   "
FT   polyA_signal    889..894
FT                   /note="putative"
FT   polyA_site      908
FT                   /note="putative"
XX
SQ   Sequence 908 BP; 266 A; 216 C; 230 G; 196 T; 0 other;
     gagaaccgct tctttccagt gcctggagac aacaatccca caagaataag gaagctctga        60
     agcaggagtc atggcagcca aacctaagct ctactacttt aatggcaggg gacggatgga       120
     gtcgatccgc tggctgctgg ctgcggctgg agtggagttt gaggaagaat ttcttgagac       180
     aagggaacag tatgagaaga tgcaaaagga tggacacctg cttttcggcc aagtaccctt       240
     ggttgaaatc gatgggatga tgctgacaca gaccagggcc atcctcagct acctcgctgc       300
     caagtacaac ttgtatggga aggacctgaa ggagagagtc aggattgaca tgtatgcaga       360
     tggcacccag gacctgatga tgatgattgc cgtggctcca tttaaaaccc ccaaggaaaa       420
     agaggagagc tatgatttga tactgtcaag agctaaaacc cgttacttcc cagtgtttga       480
     aaagatttta aaagaccacg gagaggcttt tctcgttggc aaccagctca gttgggcaga       540
     catccagctc ctagaagcca ttttgatggt ggaagaactc agtgcccctg tactgtccga       600
     cttccctctg ctgcaggcat ttaagacaag aatcagcaac attcctacaa ttaagaagtt       660
     cctgcaaccc ggaagtcaga ggaagcctcc tccagatggc ccctatgttg aggtggtcag       720
     gactgtcctg aagttctagt gcagcgtgct ttaaggtggc acccacaagg ttccaattgc       780
     agtgtcacca caggccagct gcagagcatt ccagaagcaa ggtatataga tcccaggagt       840
     caagctcttc aaacaacaaa accactctgc ccacaatgac aaatgccaat taaatacagt       900
     ggaaaacc                                                                908
//


spacer
spacer