Dbfetch

ID   AK010619; SV 1; linear; mRNA; HTC; MUS; 1734 BP.
XX
AC   AK010619;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410030I08 product:prohibitin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1734
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b3c5c14a190ed84f0e67d9c14d2da176.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018986; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018954; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018924; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018927; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019379; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018295; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018712; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018820; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018809; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018890; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018836; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019419; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018066; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018344; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031841; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0031786; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0031771; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031775; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031572; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032295; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031356; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0031487; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0031626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0031618; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0031746; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031601; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032314; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031072; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031051; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410030I08
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1734
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410030I08"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             57..875
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="prohibitin (MGD|MGI:97572)"
FT                   /note="putative"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="BAB27067.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   regulatory      1713..1718
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1734
FT                   /note="putative"
XX
SQ   Sequence 1734 BP; 417 A; 469 C; 482 G; 366 T; 0 other;
     gattcatgtg gaggtcagag tgaaagcagg tgtgagtgga agcaacagaa ggagtcatgg        60
     ctgccaaagt gtttgagtcc attggaaagt tcggcctggc gttggcagtt gcaggaggcg       120
     tggtgaactc tgctttgtat aatgtggatg ctggacacag agctgtcatc tttgaccgat       180
     tccgtggcgt acaggacatt gtggtcgggg aagggactca tttcctcatc ccttgggtac       240
     agaaaccaat tatctttgac tgccgctctc gaccacggaa cgtaccagtc atcactggta       300
     gcaaagactt gcagaacgtc aatatcacac tgcgaatcct cttccggccg gtggccagcc       360
     agcttcctcg tatctacacc agcattggcg aggactatga tgagcgggtc ctgccttcta       420
     tcaccacaga gatcctcaag tcggtggtgg ctcgattcga tgctggagaa ttgattaccc       480
     agcgagagct ggtctccagg caggtgagcg atgacctcac agagcgagcg gcaacatttg       540
     ggcttatcct ggatgacgtg tccctgacac atctgacctt cgggaaggag ttcacagagg       600
     cagtagaagc caaacaggtg gctcagcagg aagcggagag agccagattt gtggtggaaa       660
     aggctgagca gcagaagaag gcagccatca tctctgctga gggtgactcc aaggccgctg       720
     agctgatcgc caactcgctg gccacggcag gcgacggcct gatcgagctg cggaagctgg       780
     aggccgccga ggacattgcg taccagctct cccgctctcg gaacatcacc tacctgccag       840
     cgggccagtc cgtgcttctc cagcttcccc agtgaggcca gccgggccac ggcctccatc       900
     atgctgaatg acgccttcct tctgccccac cccagaaaat cactgtgaaa tttcatgatt       960
     ggcttaaagt gaaggaaata aaggtaaaat cacttcagat ctctaattat caagcgaagc      1020
     ttttattgtt acacttctta ccctctttca tatccaaaat tgccaagtgc ctctgcagac      1080
     tggccttcca ccctaggcgc gggcagttgg cagaagaaag gcagggcagt gtgtagtgga      1140
     tgggcagcct gctggcagcc tgcataggcc tagggcctcc attctgccgt atattgaaga      1200
     tttaaagaca gtggcacaca cacttgaaca aaagcaagcc ctcagtgttt ccagccattt      1260
     gaacctggac agatgcagct ggggagggcc agaggaagtg gtctatctca actgtaaggc      1320
     ccatcccctc ttaaccatga ccagcggaag caggtgtgtg tgaccagggc acggggtgaa      1380
     gaatctgccc atcaaggtgg gtgggcctca tgtcgctgcc cccaccagag tcctaaaacc      1440
     tggatggact tggacgggac aagaggcctg gactgagatg tgagtcccat ggaagacttc      1500
     ctctccaccc cccacatcgg tcctctcaaa tacccaatgg gattccagct tgaaggattg      1560
     catcctgcag ggaatgagca cacctgccaa ggacacgtgc gcctgccttc ccgctccctc      1620
     tctctcagag attgcccttt cttcccgagg gctgtgggcc agcgctccga aggaagcaat      1680
     caaggggaga aaacacagtg taagccgctg tcaataaatg acacccagac ctgc            1734
//