spacer

EBI Dbfetch

ID   AK010388; SV 1; linear; mRNA; HTC; MUS; 1758 BP.
XX
AC   AK010388;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2410004H05 product:AD-017 PROTEIN (GLYCOSYLTRANSFERASE) (CDNA
DE   FLJ14611 FIS, CLONE NT2RP1000988) homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1758
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 161037eda369e9cdd39cb257ef8b28b6.
DR   Ensembl-Gn; ENSMUSG00000021916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022476; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168584; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2410004H05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1758
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2410004H05"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             333..1448
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="AD-017 PROTEIN (GLYCOSYLTRANSFERASE) (CDNA FLJ14611
FT                   FIS, CLONE NT2RP1000988) homolog [Homo sapiens]
FT                   (SPTR|Q9P0I5, evidence: FASTY, 90%ID, 100%length,
FT                   match=1113)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q6NSU3"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1923735"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6NSU3"
FT                   /protein_id="BAB26903.1"
FT                   /translation="MSFRKVNIIIWVLAVVLFLLVLHHNFLSLSSLLKNDISDSGIVGL
FT                   QPIDFVASAHQHPVSERQEEIPVVIAASEDRLGGTIAAINSVHQNTGSNVMFYIVTFNS
FT                   TADHLRSWLNSGSLKSIRYKIVNFDTKLLEGKVKQDPDQGESMKPLTFARFYLPILVPS
FT                   AKKAIYMDDDVIVQGDILALYKTPLKPGHAAAFSEDCDSASTKVIIRGAGNQYNYIGYL
FT                   DYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNVTNQLEKWMKLNVEEGLYSRTLAG
FT                   SITTPPLLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHFKPWGRTA
FT                   SYADVWEKWYIPDPTGKFSLIRSHMDTSNIK"
XX
SQ   Sequence 1758 BP; 466 A; 409 C; 439 G; 444 T; 0 other;
     cgaggggttg tggccctacg tggctgctgc agagctcgcc ggccagtggg ccacggccag        60
     agagcagcgg acgcggacgg cccggcggtg ggccggggcc tggggcctgc ggagcgagcg       120
     ctgagctggc ggggcgggct ggggcgtggg cggcggccac tcctcccagc gcaggtaagg       180
     gcgactgcgc ccagcctcgg aaggcgacga ttcgtctgac gcggctctaa cctgacctgt       240
     cagtgcgtgg cgggatcccc ggagcgcctc accacgtccc catcactcct aagcggttaa       300
     tttctaatgt ttgtgtaaga cagaagaaaa ggatgtcatt ccgtaaagtg aacatcatca       360
     tctgggtcct ggctgttgtt ctcttcttac tggttttgca ccataacttc ctcagcttga       420
     gcagtttgtt aaagaatgac atttcagatt cgggaattgt ggggcttcag cccatagact       480
     ttgtcgccag tgctcatcag catccagtga gtgagaggca agaggagatt cccgtggtta       540
     ttgctgcctc tgaagacagg ctgggtggga ccattgcagc cataaacagc gttcatcaaa       600
     acacgggctc caatgtgatg ttttacattg ttacattcaa cagcacagca gaccatctcc       660
     ggtcctggct taacagtggt tccttgaaaa gcatcaggta caaaattgta aattttgaca       720
     ctaaactttt ggaagggaaa gtaaagcagg atcctgacca gggggagtcc atgaaaccat       780
     taacctttgc aaggttctac ttgccaattc tggttcccag tgcaaagaaa gccatataca       840
     tggatgatga tgtcattgta caaggtgaca tacttgcctt gtacaaaaca ccactgaagc       900
     caggacatgc tgctgcgttt tcagaagatt gtgactcagc ctccactaaa gtcatcatcc       960
     ggggagcagg gaaccagtac aattacattg gttatcttga ctataaaaag gaaagaattc      1020
     gtaaactttc catgaaagcc agcacctgtt cctttaatcc tggagttttt gttgcaaact      1080
     tgactgaatg gaaaagacag aatgtaacta accagttgga aaaatggatg aagctcaatg      1140
     tagaagaggg attatacagc agaactctgg caggcagcat caccacacct cctctgctta      1200
     tcgtatttta tcagcagcat tccaccattg accctatgtg gaatgtccgc catcttggtt      1260
     ccagtgctgg aaaacggtac tcaccccagt ttgtaaaagc tgccaagtta cttcactgga      1320
     atggtcactt caagccttgg ggaagaactg cttcatatgc tgatgtttgg gaaaagtggt      1380
     atattccaga cccaacagga aaattcagtt taatccgaag tcatatggat acctcaaaca      1440
     taaagtgaac tacaatttaa gctaattgcg tcactcagga aactctggaa gacacactat      1500
     gtgggaaggt aacagttgta gggcttgagt ttctctatac caaccacaga aaacacttca      1560
     gctgggtaga agtcatagat atccagatga ctaccacggc tccatctgcc ttaccaaatg      1620
     tttgctttac tatactgctg acttgaagga cagagaactc cagcatttaa ctgcatctag      1680
     ctgctgtagg taggaactgc tgtttggttt tagttttgta ccttgtggcc tggtttgtaa      1740
     ataaaatcta cattttcc                                                    1758
//


spacer
spacer