Dbfetch

ID   AK010292; SV 1; linear; mRNA; HTC; MUS; 972 BP.
XX
AC   AK010292;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus ES cells cDNA, RIKEN full-length enriched library,
DE   clone:2400006P09 product:RIBONUCLEASE HI LARGE SUBUNIT (EC 3.1.26.-) (RNASE
DE   HI LARGE SUBUNIT) (RNASE H(35)) (RIBONUCLEASE H2) (RNASE H2) homolog [Homo
DE   sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-972
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0f5b2cbedbc9ab55f3e4a1e84e7fe099.
DR   Ensembl-Gn; ENSMUSG00000052926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147812; mus_musculus.
DR   EuropePMC; PMC369447; 14747562.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2400006P09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2400006P09"
FT                   /cell_type="ES cells"
FT                   /db_xref="taxon:10090"
FT   CDS             16..921
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="RIBONUCLEASE HI LARGE SUBUNIT (EC 3.1.26.-) (RNASE
FT                   HI LARGE SUBUNIT) (RNASE H(35)) (RIBONUCLEASE H2) (RNASE
FT                   H2) homolog [Homo sapiens] (SWISSPROT|O75792, evidence:
FT                   FASTY, 85.7%ID, 100%length, match=903)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CWY8"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="MGI:MGI:1916974"
FT                   /db_xref="PDB:3KIO"
FT                   /db_xref="PDB:3P5J"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CWY8"
FT                   /protein_id="BAB26828.1"
FT                   /translation="MDLSELERDNTGRCRLSSPVPAVCLKEPCVLGVDEAGRGPVLGPM
FT                   VYAICYCPLSRLADLEALKVADSKTLTENERERLFAKMEEDGDFVGWALDVLSPNLIST
FT                   SMLGRVKYNLNSLSHDTAAGLIQYALDRNVNVTQVFVDTVGMPETYQARLQQHFPGIEV
FT                   TVKAKADSLFPVVSAASIFAKVARDKAVKNWQFVENLQDLDSDYGSGYPNDPKTKAWLR
FT                   KHVDPVFGFPQFVRFSWSTAQAILEKEAEDVIWEDSEAEEDPERPGKITSYFSQGPQTC
FT                   RPQAPHRYFQERGLEAASSL"
FT   regulatory      959..964
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      972
FT                   /note="putative"
XX
SQ   Sequence 972 BP; 223 A; 257 C; 285 G; 207 T; 0 other;
     ggtcgcagag gcagcatgga tctcagcgag ctggagaggg acaatacggg tcgttgtcgt        60
     ctgagttctc ctgtacctgc tgtgtgtctc aaggagccgt gcgttctggg cgtggatgaa       120
     gcgggccgag gccctgtgct tggtcccatg gtctacgcca tctgttactg ccccctgtct       180
     cgcttggcag atctggaggc cctgaaagtg gcagactcta agaccttgac agagaacgag       240
     cgggagaggc tctttgcgaa aatggaggag gatggagact ttgtgggttg ggctttggac       300
     gtcctgtctc caaacctgat ctctaccagc atgcttgggc gagtcaagta caacctcaac       360
     tccctgtcac acgatacagc tgcggggctg atacagtacg cactggaccg gaatgtgaat       420
     gtcactcagg tatttgtgga cactgtagga atgccagaga cataccaggc tcgattacaa       480
     cagcactttc ccgggataga ggtgacagtc aaggccaaag ctgactccct gttccctgtg       540
     gtcagtgctg ccagcatctt tgccaaggtg gcccgagaca aggctgtgaa gaactggcag       600
     tttgtggaaa atttacagga tctggactcc gattatggct caggctatcc caatgatccc       660
     aagaccaaag cctggctgag gaaacatgtg gaccctgtgt ttggctttcc ccagtttgta       720
     cggttcagtt ggagcacagc ccaggccatc ctggagaagg aggcagaaga tgtcatttgg       780
     gaggactcag aagctgagga ggatcctgaa agaccgggaa aaatcacctc ctacttcagc       840
     cagggcccgc agacctgccg ccctcaggcc ccccacagat acttccagga gcgaggcctg       900
     gaggcagcca gcagcctcta ggagcccatg tgtgcaccac ctgcccttct aacccaggaa       960
     taaaagctgt tc                                                           972
//