Dbfetch

ID   AK009686; SV 1; linear; mRNA; HTC; MUS; 873 BP.
XX
AC   AK009686;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male tongue cDNA, RIKEN full-length enriched library,
DE   clone:2310039A20 product:regulator of G-protein signalling 10, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-873
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; dbee7037fd35f40510739cab45efefbd.
DR   Ensembl-Gn; ENSMUSG00000030844; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033082; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033064; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032996; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033065; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032779; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033575; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032109; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032752; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032904; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032857; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032998; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032889; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033594; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031815; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032220; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000033133; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087009; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087090; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087028; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087050; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0086611; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087130; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086556; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0086750; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086593; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0086782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0086631; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0087844; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086538; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0085650; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2310039A20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..873
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2310039A20"
FT                   /tissue_type="tongue"
FT                   /db_xref="taxon:10090"
FT   CDS             61..606
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="regulator of G-protein signalling 10
FT                   (MGD|MGI:1915115)"
FT                   /db_xref="GOA:Q9CQE5"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1915115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQE5"
FT                   /protein_id="BAB26440.1"
FT                   /translation="MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENL
FT                   LEDPEGVQRFREFLKKEFSEENVLFWLACEDFKKTEDRKQMQEKAKEIYMTFLSNKASS
FT                   QVNVEGQSRLTEKILEEPHPLMFQKLQDQIFNLMKYDSYSRFLKSDLFLKPKRTEEEEE
FT                   EPPDAQTAAKRASRIYNT"
FT   regulatory      853..858
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      873
FT                   /note="putative"
XX
SQ   Sequence 873 BP; 236 A; 219 C; 226 G; 192 T; 0 other;
     gcctcttcgg gcttagccgc cgcgctgccc ggctgctccg tcctctggac gcccgcggcg        60
     atgttcaccc gcgccgtgag ccgactgagc aggaagcggc cgccgtctga tatccatgac       120
     ggagatggga gctcaagcag cggccaccag agccttaaga gcacagccaa gtgggcatcc       180
     tccctggaga atcttctgga agacccagaa ggggtgcaga gattcaggga gtttctgaag       240
     aaggaattca gcgaagagaa tgtcttgttt tggctagcgt gtgaagattt caagaaaacg       300
     gaggacagga agcagatgca ggaaaaggcc aaggagatct acatgacctt cctgtccaat       360
     aaggcctctt cacaagtcaa cgtggagggg cagtctcggc tcactgaaaa gattctggaa       420
     gagccacacc ctctgatgtt ccaaaagctc caggaccaga tcttcaatct catgaagtat       480
     gacagctaca gccgcttctt gaagtctgac ttgtttctga aacccaagcg aactgaggaa       540
     gaggaagaag agcccccgga tgctcagacc gcagctaagc gagcctccag aatttacaac       600
     acataagctg agcccttcac cccagcgaag gagagggatg gactcttagg actgtacagg       660
     ctgtcatttc tttgttgtgt ttgaggactg gagtgtgcta gaccttccct ctggatatgt       720
     gtattttatt aactgaacag caacctctgc atgatgctaa tcttccatta aaaacaaaag       780
     tagctttaaa gtgtcagttc acaaaaacac atgagattct gccaatactg gacactcagc       840
     ctttcaatcc tgattaaagt gttcgtgaag ctc                                    873
//