Dbfetch

ID   AK008700; SV 1; linear; mRNA; HTC; MUS; 3071 BP.
XX
AC   AK008700;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male stomach cDNA, RIKEN full-length enriched library,
DE   clone:2210010L24 product:solute carrier family 39 (iron-regulated
DE   transporter), member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3071
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a7da28ee5b9e6b18d35c2ede32c2b478.
DR   Ensembl-Gn; ENSMUSG00000025993; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0015996; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015934; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016387; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015349; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015910; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015410; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000027137; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019694; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019671; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019628; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019620; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019449; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020119; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018956; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019517; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019523; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019493; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020173; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018713; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019044; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2210010L24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3071
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2210010L24"
FT                   /tissue_type="stomach"
FT                   /db_xref="taxon:10090"
FT   CDS             136..1848
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 39 (iron-regulated
FT                   transporter), member 1 (MGD|MGI:1315204 GB|NM_016917,
FT                   evidence: BLASTN, 98%, match=3071)"
FT                   /db_xref="GOA:Q9JHI9"
FT                   /db_xref="InterPro:IPR009716"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1315204"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JHI9"
FT                   /protein_id="BAB25840.1"
FT                   /translation="MTKARDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFA
FT                   VSVFLVELYGNSLLLTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVI
FT                   LCGIILMMVFLHKNELLTMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVA
FT                   GENRSRLADMNATIRRIDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFL
FT                   LWKVYQKTPALAVKAALKVEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQE
FT                   PTCASQMAEPFRTFRDGWVSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGS
FT                   ILSILMGASAITGIMGTVAFTWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLD
FT                   LSVSPFEDIRSRFVNVEPVSPTTKIPETVFTTEMHMSNMSNVHEMSTKPIPIVSVSLLF
FT                   AGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPE
FT                   AFGLLVLISVSFVAMGHLMYFRFAQKTLGNQIFVCGPDEKEVTDENQPNTSVV"
XX
SQ   Sequence 3071 BP; 819 A; 647 C; 682 G; 923 T; 0 other;
     gggtctttcg gcataaggct gttgtgctta tactggtgct atcttcggtt cctctcactc        60
     ctgtgaacaa gctcccgggc aagagcagct aaagctacca gcatcagaac aaacaagggg       120
     agaacgcctg gtgtcatgac caaggcaaga gatcaaaccc atcaggaagg atgctgtgga       180
     tccttagcaa actacctgac ctcagcaaaa ttcctcctct accttggcca ctctctctcc       240
     acttgggggg atcggatgtg gcactttgca gtgtctgtgt ttctggtgga actctatgga       300
     aacagccttc tcttgacagc tgtctatgga ctggtggtgg caggctctgt tctggtcctg       360
     ggagccatca ttggtgactg ggtggataag aatgccagac ttaaagtggc ccagacgtca       420
     ctggtggttc agaatgtgtc cgtcatcctc tgcggaatca tcctgatgat ggttttccta       480
     cacaagaatg agctcctgac catgtaccat ggatgggtcc ttactgtctg ctacatcctg       540
     atcatcacta ttgcaaacat tgcaaatttg gccagtactg ccactgcgat cacaatccaa       600
     agggactgga ttgttgttgt ggcaggagaa aacaggagca gattagcaga catgaatgct       660
     accattagaa ggattgacca gctaaccaac atcctggccc ccatggctgt cgggcagatt       720
     atgacatttg gttctccagt cattggctgt ggttttattt ccggttggaa tttggtgtcc       780
     atgtgtgtgg agtacttctt gctctggaag gtttaccaga agacccctgc tctggctgta       840
     aaagctgctc tcaaggtaga ggagtcagaa ctgaagcagc tgacctcacc taaagatact       900
     gagccaaaac ctttggaggg aactcatcta atgggtgaga aagactccaa catccgtgaa       960
     cttgaatgtg aacaagagcc cacctgtgcc tcccagatgg cagagccctt ccgcactttc      1020
     cgagatggat gggtctccta ctataaccag ccagtgtttc tggctggcat gggcctggct      1080
     ttcctctata tgacagtcct gggctttgac tgtatcacta cagggtacgc ctacactcag      1140
     gggctgagtg gatccatcct tagtattttg atgggagcat cagcaataac tggaataatg      1200
     ggaactgtgg ccttcacctg gctacgtcga aaatgtggcc ttgttcggac tggtctattc      1260
     tcaggactag cccagctttc ctgtttaatc ttgtgtgtga tctccgtatt catgcctgga      1320
     agccccttgg acctgtctgt ttctccattt gaagatatcc gttctaggtt tgtgaatgtg      1380
     gagccagtgt ccccaactac caaaatacct gagaccgtct ttacaacaga aatgcatatg      1440
     tccaacatgt ctaatgtcca tgagatgagt actaaaccca tccccatagt ctctgtcagc      1500
     ctgctgtttg caggagtcat tgctgctaga atcggtcttt ggtcctttga tttgacggtg      1560
     acacagttgc tgcaagaaaa tgtaattgaa tctgaaagag gcattatcaa tggtgtgcag      1620
     aactccatga actaccttct tgaccttctg catttcatca tggtcatctt ggccccaaat      1680
     cctgaagctt ttggcttgct ggtattgatt tcagtctcct ttgtggcaat gggacatctt      1740
     atgtatttcc gatttgccca gaagactctg ggcaaccaga tttttgtttg tggtcctgat      1800
     gaaaaagaag ttacagatga aaatcaaccg aatacatctg ttgtataaaa atagtttagc      1860
     tgtggcccct gttactagat tgtggagagc atgtgtgctt attttgtact gcagaatccc      1920
     aataaatgcc tgcatttctc tctggtttta ccacatctgt gccttaaggg ctaggagcac      1980
     taactaacca tcgccagcaa agatggttat ttctccttac atgtaaacat tggaaaatag      2040
     gaagagggag aggcagtcag cgtgtgtata ggaagggttt aatggtaaaa tgaacttccc      2100
     ttactcttat gagtatatta aattttaaag agtggttgtc aggtgagtaa aattattcct      2160
     tagcagatat ttattatcta ctggaatgat aaatcaattc accctaaaac tcactcttgt      2220
     aaaactctgc tccacttcct ttttttaaga tcagtgatat ttttctcagt tacattacag      2280
     aaacaagttt ttcctccatg tatgaaggtt atagttagat aatgaatgtt atccttatta      2340
     atcccattga acttaaggaa tttattgtat gtggaggatg aaatgtgtaa ctagacttgt      2400
     ccaaaaggtt catggaataa cttttgcatt ttgaccatca gaaagggcaa aatattacag      2460
     taatgtgtgt atggtggctc ttcataaaat gactctcaaa atctgcagaa agaagaaaag      2520
     ttgtaggttt ctagtgtggt acagaaggac ttaaagcttg ttattagtgt gattgtagaa      2580
     actggaagct aagggtgagg acctcatgta accagagtca ctgtcatcag ccatcactaa      2640
     ctattttggt aaatgagaga actgacctgg caccttacaa gcagaaaagc ggcccacact      2700
     aagaaaggac tgcaaatcag tgagtctgta tagaacattt taccttcact gacttgggcc      2760
     gatgtgtttg tcatctctgt gtttttctag agcaagaata gtcacaaaag ttcccctttc      2820
     aatatccctg agaagaataa agaaaaaact gtttgtaaat atttttttaa aactgttctg      2880
     caagtctttt tgtaacatgc agtaccaaca tgggacattg ccttaacttt tgatgcactt      2940
     tcatggagac tgactgccat gcattgctgt gagcactttc tttgtcgttc agtttaatct      3000
     tttccttcac ctttattaca gtatgacata atgatctact atgttgtcaa agcttcataa      3060
     aatatttcta t                                                           3071
//