Dbfetch

ID   AK008674; SV 1; linear; mRNA; HTC; MUS; 1963 BP.
XX
AC   AK008674;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male stomach cDNA, RIKEN full-length enriched library,
DE   clone:2210008L19 product:UDP-GlcNAc:betaGal
DE   beta-1,3-N-acetylglucosaminyltransferase 3, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1963
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 5509000dda60ec773e529b66478d38fa.
DR   Ensembl-Gn; ENSMUSG00000031803; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033762; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033745; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033671; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033741; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033451; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034259; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032776; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033429; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033583; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033525; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033670; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033572; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034276; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032483; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032892; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034260; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0089383; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0089466; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0089405; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0089405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0088971; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0089922; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0089514; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0088920; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0089114; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0088953; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0089139; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0088982; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0090224; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0088941; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0088013; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2210008L19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1963
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2210008L19"
FT                   /tissue_type="stomach"
FT                   /db_xref="taxon:10090"
FT   CDS             139..1257
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3
FT                   (MGD|MGI:2152535)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q5JCS9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:2152535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5JCS9"
FT                   /protein_id="BAB25824.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVA
FT                   AIRRAARVLPMFPVDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
XX
SQ   Sequence 1963 BP; 381 A; 619 C; 532 G; 431 T; 0 other;
     gagtgttctc ctaacagcct tcagatgaag atgcagaact ctcagctcct cctgcaccat        60
     gcctgcctgg atgctgctgc catgctccca ccttgatggt aatggactga acctctgaac       120
     ctgctccgcc cccacgccat gcggctgcca aggcagagcc cctacgagat cctcctcctg       180
     gtcttggtcg ccttgctggt gctgctgctg ctcctgacca gcaagtcacc gcccagctgc       240
     tctgcccctg agaggtccaa ggagcctgaa gacaaccccg ggtgggccac gggccaccca       300
     cgcacacacc ccgcccggtg ccgagctaat ctatccgtgt cctcgcaccc cgacttcgcg       360
     gggctgccct tacacgtgcg cgacttcttg ttctaccgcc actgccgcga cttcccagtg       420
     ctccgagagc cgcgggttac caagtgcgcg gagcccgtgt tcctgctgct cgccatcaag       480
     tcctcgcctg caaactatgg gcgccgccag atgctgcgca cgacgtgggc gcgcgagaga       540
     cgggtgcgtg gggcgccact gcgccgcctc ttccttgtgg gctcagaccg cgacccacaa       600
     caagcacgca aatacaaccg actgctggag ctggaagcgc agaaatacgg cgacattctc       660
     cagtgggatt tccatgactc cttctttaac ctgacgctta agcaggtcct tttcctggag       720
     tggcagctaa cctactgtac caacgccagc ttcgtgctca atggggacga cgatgtgttc       780
     gcacacacgg acaacatggt cacctacctg caggaccacg acccggacca acacctcttc       840
     gtggggcacc tgatccagaa cgtgggtccc atccgggtgc cctggagcaa gtacttcatc       900
     cccgctctgg tgatggcgga ggacagatac ccgccctact gtggtggcgg cggcttcctg       960
     ctgtcgcgtt ttaccgtggc cgccatacgt cgcgccgcgc gcgtcctccc catgttccca      1020
     gtcgacgacg tgttcctggg catgtgtctg cagcagcagg gtctggctcc cgggacgcac      1080
     agcggagtgc gcactgcggg ggttttcccc cctagcccac gtgtgtcatc cttcgacccc      1140
     tgcttctacc gcgacctgct cctcgtgcac cgcttcctgc ccttcgagat gctgctgatg      1200
     tgggatgcgc tgaaccagcc ccagctcctc tgcggcaggc agagccccgc ctactgagag      1260
     gtttggggga gttgacatcc cctagctcat gtcctgcctc atccacgtgc aaagggctgg      1320
     cttcaaggag aagttcaaag tgaggggcag aaaggtgggt ctgaggagtt catagggcaa      1380
     actcctaagt acgcttggaa accctcttgg tactgttcac agcaggaact ctgagtctag      1440
     ccaactctga gtggctctaa gtggccgcta agcaaaaact gctgtggaca gagcccatgg      1500
     gttttaggct ctgggccttg gcctctctca ggcccccaag gaattgggca gaggaacaag      1560
     gtggatttta aactgaggtg ctcagagatc ttgacttgac ccccactagt gtctcccaag      1620
     aacttggaga accacagggg caggaggggt cctgtgtccc acagaccggg ctggcaggaa      1680
     ataaagtcca tagaaggttg aacgtgattg tagggggaag gttaagataa aactcagggc      1740
     tctgccacgt tttaatttta tctatttagg aagggagcca ggtcctgtct tcctctctgt      1800
     ttgggtcctg ggacttgaac tcaaatcttc aggcttggca gcaagtgcct ccattaactg      1860
     agtcatctcg ccagtgcctt tttagttttc agcactactc atgttttaac accggctgct      1920
     ctaccccacc tctctttgac cttcaatatt aactcattgc aac                        1963
//