Dbfetch

ID   AK008317; SV 1; linear; mRNA; HTC; MUS; 2051 BP.
XX
AC   AK008317;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010106C01 product:dolichyl-phosphate
DE   alpha-N-acetylglucosaminephosphotransferase 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2051
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7e1b8d225dda0c3666a1b9a44b8f6615.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010106C01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2051
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010106C01"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS             375..1280
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="dolichyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase 2
FT                   (MGD|MGI:1196396 GB|NM_007875, evidence: BLASTN, 99%,
FT                   match=1417)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CPT1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR033895"
FT                   /db_xref="MGI:MGI:1196396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPT1"
FT                   /protein_id="BAB25597.1"
FT                   /translation="MIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVP
FT                   KPFRWILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLV
FT                   ELEGDYRDDHIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGH
FT                   FSKTMLLFFMPQVFNFLYSLPQLFHIIPCPRHRMPRLNAKTGKLEMSYSKFKTKNLSFL
FT                   GTFILKVAENLRLVTVHQGESEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQV
FT                   LSSAATFSIRYQLVRLFYDV"
XX
SQ   Sequence 2051 BP; 420 A; 584 C; 482 G; 565 T; 0 other;
     cgaggaggga gggtcaggtc ctagcgtcct agctgggttt tgttcccgct ggcgccggaa        60
     tcctctgcgg gttgggagcc gcactgccgg ctgccgaggc cacgggattg ttcctggctt       120
     accagttagc tgagtaggcg gcggggcggc ggccaccgga gggtcaccat gtgggccttc       180
     ccggagttgc ccctgccgct gccgctgctg gtgaatttga tcggctcgct gttgggattc       240
     gtggctacag tcaccctcat ccctgccttc cgtagccact ttatcgccgc gcgcctctgt       300
     ggccaggacc tcaacaagct cagccagcag cagattttgt ggccctaata ggtgccctcc       360
     ttgccatctg ctgcatgatc ttcctggggt ttgctgatga tgtcctcaat ctccgctggc       420
     gccacaagct gctgctgccc acagctgcct cactacctct cctcatggtc tacttcacaa       480
     actttggcaa tacaaccatc gtggtgccca agcccttccg ctggattctg ggcctgcatt       540
     tggacttggg gatcctgtac tacgtctaca tggggctgct tgcagtgttc tgtaccaatg       600
     ccatcaacat cctggcgggc attaatggcc tagaggccgg tcagtcacta gtcatctctg       660
     cttctatcat tgtcttcaac ctggtggaac tggaaggtga ttatcgagat gatcatatct       720
     tttcccttta cttcatgata ccatttttct ttaccacctt gggactgctt taccacaact       780
     ggtacccgtc ccgcgtgttt gtgggagaca ccttctgtta ctttgcgggc atgacttttg       840
     ccgtggtggg gatcttggga cacttcagca agaccatgct gctcttcttt atgccacaag       900
     tattcaattt cctctactca ctgcctcagc tcttccatat catcccctgc cctcgacacc       960
     ggatgcccag actcaacgca aagacaggca aactggaaat gagctattcc aagttcaaga      1020
     ccaagaacct ctctttcctg ggcaccttta ttttaaaggt agcagagaac ctccggttag      1080
     tgacagttca ccaaggtgag agtgaggacg gtgccttcac tgagtgtaac aacatgaccc      1140
     tcatcaactt gctacttaaa gtctttgggc ctatacatga gagaaacctc accctgctcc      1200
     tgctgctcct gcaggtccta agcagcgccg ccaccttctc cattcgttac caactcgtcc      1260
     gactcttcta tgatgtctga gctccctgac agctgccctt tacctcacag tctccattgg      1320
     acctcagcca ggaccagcct ctgtctggtc cgagatgacc ctctggtcca ggcctcgctg      1380
     acacttttgt tctcagcttc tgccatctgt gactactgat atcctggatg gacaccttgc      1440
     tggacttgaa gtccgctagt tggactttgc ctagggcttt catcttgcct tgccctccct      1500
     ttctgtccca tctgcagcct caccaggtgg gcttgagcct ctattatgca aatattcgta      1560
     gctcagcttt cagagcgcta actctaaagg aattcacctg agccttgaga gagaacctgg      1620
     gctagggcta gagttagggc tacatactcc aaggtgacct cacatttgac tatcaaatga      1680
     agtgttgtga ttgggaagcg tagaggcagg gccatgtgct cagaacggtg acaataaagg      1740
     actgcctttt acttgttcct ctagtgtagc atccgctccc tctgtccttt ttaaccttcg      1800
     tggtgcttca ggagtgaaca ccggggcttc cttatactta actgctctac cactgaacta      1860
     tatgccaagt ctggtatatt tattttttat ataggcattt taggatagat tggaagggtt      1920
     agaccgggta cctttcccaa taggataccg atctctgttc catcagaccc tttcttgcaa      1980
     aaaaggcctg tcacaaacta agaccagaca gaacatgttg aataaatatc gcagcacaaa      2040
     cttgtgatag c                                                           2051
//