spacer

EBI Dbfetch

ID   AK008246; SV 1; linear; mRNA; HTC; MUS; 2050 BP.
XX
AC   AK008246;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010015C13 product:dolichyl-phosphate
DE   alpha-N-acetylglucosaminephosphotransferase 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2050
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 22c46b2984098a59f57a319dbca8cfe7.
DR   Ensembl-Gn; ENSMUSG00000032123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054708; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010015C13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2050
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010015C13"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS             374..1279
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="dolichyl-phosphate
FT                   alpha-N-acetylglucosaminephosphotransferase 2
FT                   (MGD|MGI:1196396 GB|NM_007875, evidence: BLASTN, 99%,
FT                   match=1417)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CPT1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="MGI:MGI:1196396"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CPT1"
FT                   /protein_id="BAB25555.1"
FT                   /translation="MIFLGFADDVLNLRWRHKLLLPTAASLPLLMVYFTNFGNTTIVVP
FT                   KPFRWILGLHLDLGILYYVYMGLLAVFCTNAINILAGINGLEAGQSLVISASIIVFNLV
FT                   ELEGDYRDDHIFSLYFMIPFFFTTLGLLYHNWYPSRVFVGDTFCYFAGMTFAVVGILGH
FT                   FSKTMLLFFMPQVFNFLYSLPQLFHIIPCPRHRMPRLNAKTGKLEMSYSKFKTKNLSFL
FT                   GTFILKVAENLRLVTVHQGESEDGAFTECNNMTLINLLLKVFGPIHERNLTLLLLLLQV
FT                   LSSAATFSIRYQLVRLFYDV"
XX
SQ   Sequence 2050 BP; 421 A; 584 C; 481 G; 564 T; 0 other;
     gaggagggag ggtcaggtcc aagcgtccta gctgggtttt gttcccgctg gcgccggaat        60
     cctctgcggg ttgggagccg cactgccggc tgccgaggcc acgggattgt tcctggctta       120
     ccagttagct gagtaggcgg cggggcggcg gccaccggag ggtcaccatg tgggccttcc       180
     cggagttgcc cctgccgctg ccgctgctgg tgaatttgat cggctcgctg ttgggattcg       240
     tggctacagt caccctcatc cctgccttcc gtagccactt tatcgccgcg cgcctctgtg       300
     gccaggacct caacaagctc agccagcagc agattttgtg gccctaatag gtgccctcct       360
     tgccatctgc tgcatgatct tcctggggtt tgctgatgat gtcctcaatc tccgctggcg       420
     ccacaagctg ctgctgccca cagctgcctc actacctctc ctcatggtct acttcacaaa       480
     ctttggcaat acaaccatcg tggtgcccaa gcccttccgc tggattctgg gcctgcattt       540
     ggacttgggg atcctgtact acgtctacat ggggctgctt gcagtgttct gtaccaatgc       600
     catcaacatc ctggcgggca ttaatggcct agaggccggt cagtcactag tcatctctgc       660
     ttctatcatt gtcttcaacc tggtggaact ggaaggtgat tatcgagatg atcatatctt       720
     ttccctttac ttcatgatac catttttctt taccaccttg ggactgcttt accacaactg       780
     gtacccgtcc cgcgtgtttg tgggagacac cttctgttac tttgcgggca tgacttttgc       840
     cgtggtgggg atcttgggac acttcagcaa gaccatgctg ctcttcttta tgccacaagt       900
     attcaatttc ctctactcac tgcctcagct cttccatatc atcccctgcc ctcgacaccg       960
     gatgcccaga ctcaacgcaa agacaggcaa actggaaatg agctattcca agttcaagac      1020
     caagaacctc tctttcctgg gcacctttat tttaaaggta gcagagaacc tccggttagt      1080
     gacagttcac caaggtgaga gtgaggacgg tgccttcact gagtgtaaca acatgaccct      1140
     catcaacttg ctacttaaag tctttgggcc tatacatgag agaaacctca ccctgctcct      1200
     gctgctcctg caggtcctaa gcagcgccgc caccttctcc attcgttacc aactcgtccg      1260
     actcttctat gatgtctgag ctccctgaca gctgcccttt acctcacagt ctccattgga      1320
     cctcagccag gaccagcctc tgtctggtcc gagatgaccc tctggtccag gcctcgctga      1380
     cacttttgtt ctcagcttct gccatctgtg actactgata tcctggatgg acaccttgct      1440
     ggacttgaag tccgctagtt ggactttgcc tagggctttc atcttgcctt gccctccctt      1500
     tctgtcccat ctgcagcctc accaggtggg cttgagcctc tattatgcaa atattcgtag      1560
     ctcagctttc agagcgctaa ctctaaagga attcacctga gccttgagag agaacctggg      1620
     ctagggctag agttagggct acatactcca aggtgacctc acatttgact atcaaatgaa      1680
     gtgttgtgat tgggaagcgt agaggcaggg ccatgtgctc agaacggtga caataaagga      1740
     ctgcctttta cttgttcctc tagtgtagca tccgctccct ctgtcctttt taaccttcgt      1800
     ggtgcttcag gagtgaacac cggggcttcc ttatacttaa ctgctctacc actgaactat      1860
     atgccaagtc tggtatattt attttttata taggcatttt aggatagatt ggaagggtta      1920
     gaccgggtac ctttcccaat aggataccga tctctgttcc atcagaccct ttcttgcaaa      1980
     aaagccctgt cacaaactaa gaccagacag aacatgttga ataaatatcg cagcacaaac      2040
     ttgtgatagc                                                             2050
//


spacer
spacer