Dbfetch

ID   AK008189; SV 1; linear; mRNA; HTC; MUS; 943 BP.
XX
AC   AK008189;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010011I18 product:glutathione S-transferase, alpha 4, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-943
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b442cd74b024f8df8606061636c383a6.
DR   Ensembl-Gn; ENSMUSG00000032348; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035059; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035040; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034969; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034741; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035550; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034063; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034713; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034873; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034815; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034954; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034856; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035573; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033767; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034175; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034903; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0093403; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093348; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093323; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0092899; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0093840; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0093513; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0092827; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093035; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0092884; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093041; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0092875; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094156; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0092926; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0091911; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010011I18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..943
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010011I18"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS             106..774
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione S-transferase, alpha 4 (MGD|MGI:1309515
FT                   GB|NM_010357, evidence: BLASTN, 99%, match=906)"
FT                   /note="putative"
FT                   /db_xref="GOA:P24472"
FT                   /db_xref="InterPro:IPR003080"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:1309515"
FT                   /db_xref="PDB:1B48"
FT                   /db_xref="PDB:1GUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P24472"
FT                   /protein_id="BAB25520.1"
FT                   /translation="MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQ
FT                   KDGHLLFGQVPLVEIDGMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMM
FT                   MIAVAPFKTPKEKEESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEA
FT                   ILMVEELSAPVLSDFPLLQAFKTRISNIPTIKKFLQPGSQRKPPPDGPYVEVVRTVLKF
FT                   "
FT   regulatory      924..929
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      943
FT                   /note="putative"
XX
SQ   Sequence 943 BP; 274 A; 223 C; 243 G; 203 T; 0 other;
     gaaaagacga ctgcaggact ggtgactttc gctcgcagaa ccgcttcttt ccagtgcctg        60
     gagacaacaa tcccacaaga ataaggaagc tctgaagcag gagtcatggc agccaaacct       120
     aagctctact actttaatgg caggggacgg atggagtcga tccgctggct gctggctgcg       180
     gctggagtgg agtttgagga agaatttctt gagacaaggg aacagtatga gaagatgcaa       240
     aaggatggac acctgctttt cggccaagta cccttggttg aaatcgatgg gatgatgctg       300
     acacagacca gggccatcct cagctacctc gctgccaagt acaacttgta tgggaaggac       360
     ctgaaggaga gagtcaggat tgacatgtat gcagatggca cccaggacct gatgatgatg       420
     attgccgtgg ctccatttaa aacccccaag gaaaaagagg agagctatga tttgatactg       480
     tcaagagcta aaacccgtta cttcccagtg tttgaaaaga ttttaaaaga ccacggagag       540
     gcttttctcg ttggcaacca gctcagttgg gcagacatcc agctcctaga agccattttg       600
     atggtggaag aactcagtgc ccctgtactg tccgacttcc ctctgctgca ggcatttaag       660
     acaagaatca gcaacattcc tacaattaag aagttcctgc aacccggaag tcagaggaag       720
     cctcctccag atggccccta tgttgaggtg gtcaggactg tcctgaagtt ctagtgcagc       780
     gtgctttaag gtggcaccca caagggtcca attgcagtgt cacacaggcc agctgcagag       840
     cattccagaa gcaaggtata tagatcccag gagtcaagct cttcaaacaa caaaaccact       900
     ctgcgccaca atgacaaatg ccaattaaat acagtgggaa act                         943
//