spacer

EBI Dbfetch

ID   AK008101; SV 1; linear; mRNA; HTC; MUS; 1141 BP.
XX
AC   AK008101;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 21)
XX
DE   Mus musculus adult male small intestine cDNA, RIKEN full-length enriched
DE   library, clone:2010004M05 product:CD97 antigen, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1141
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d76b7f471569581054575c843fca7581.
DR   Ensembl-Gn; ENSMUSG00000002885; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002964; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=2010004M05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1141
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="2010004M05"
FT                   /tissue_type="small intestine"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..640
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="CD97 antigen (MGD|MGI:1347095)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q9Z0M6"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003056"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="MGI:MGI:1347095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z0M6"
FT                   /protein_id="BAB25461.1"
FT                   /translation="AAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVAI
FT                   SMAVVKMDGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSEIN
FT                   PNMKKLRKARVLTITSIAQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVM
FT                   LCLLNKKVREEYWKWACMVTGSKYTEINSSTTGTGTSQTRALRSSESGM"
FT   polyA_signal    1126..1131
FT                   /note="putative"
FT   polyA_site      1141
FT                   /note="putative"
XX
SQ   Sequence 1141 BP; 261 A; 317 C; 294 G; 269 T; 0 other;
     ggccgccttc tgctggatgg cactggaggg cgtggagctc tacttcctgg tggtgcgtgt        60
     gttccagggc caaggcctga gtacatggca acgctgcctg attggctacg gggtgcccct       120
     cctcatcgtg gccatctcaa tggcagttgt caaaatggat ggctatgggc atgcaacata       180
     ctgctggctg gactttagga agcagggctt tctctggagc ttttcgggac ccgtggcctt       240
     catcattttc tgcaatgctg ccattttcgt gatcactgtc tggaagctca caaagaagtt       300
     ttctgaaatc aacccaaaca tgaagaagtt aaggaaggcg agggtgctga ccatcacctc       360
     catcgcccag ctccttgtgc tgggctgcac ctggggcttc ggcctgttcc tcttcaaccc       420
     ccatagcaca tggctatcct acatctttac cctgctcaac tgcctgcagg gcctattcct       480
     ctatgtgatg ctctgcctgc tcaacaaaaa ggtgagggaa gagtactgga aatgggcctg       540
     catggtcact gggagcaagt acacagagat caactcttcc acaacaggca ctggcaccag       600
     ccaaacacgg gctctcaggt cctcagaatc agggatgtga aggcgagttc catgaaggac       660
     agcagcacat actcacggct gtcattctgc cttctgttcc tgccaccttt cggcctttga       720
     ccccacttca tataaagaag ggatgcaaac ccagcaatga gccctgccac ggggcaaggg       780
     gtcgctggtc ctgcttctgg ttgtctctgc ctcaccacag ctactgccta ccagagaaac       840
     agaatgcagc cagcccagac ctgcagccca ctgcctggta cacgaggcag gcagtcctag       900
     gacaaaggga agagcccttg agacctgggc tctttgccag ggtgctgggt tcagtttcct       960
     taagctaaga ctgtggatgc aacgtcagcc actgaagccc gcctgatgct gaggctcacg      1020
     gtacagaggc ctcgctgctc cacatccagg gcagaaggtc tcacagctaa agactaggtt      1080
     ttgtaatttt tttaacctgt aaacctttca atgttgacat acaaaattaa atatcatatt      1140
     g                                                                      1141
//


spacer
spacer