spacer

EBI Dbfetch

ID   AK007808; SV 1; linear; mRNA; HTC; MUS; 2111 BP.
XX
AC   AK007808;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10 day old male pancreas cDNA, RIKEN full-length enriched
DE   library, clone:1810047I05 product:chemokine (C-C) receptor 1,-like 2, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2111
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2358ba47b64f95450ada05cf10517b71.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1810047I05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2111
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10 day old"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1810047I05"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS             518..1600
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C-C) receptor 1,-like 2 (MGD|MGI:1920904
FT                   GB|NM_017466, evidence: BLASTN, 98%, match=2039)"
FT                   /note="putative"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35457"
FT                   /protein_id="BAB25273.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
FT   polyA_signal    2088..2093
FT                   /note="putative"
FT   polyA_site      2111
FT                   /note="putative"
XX
SQ   Sequence 2111 BP; 500 A; 525 C; 518 G; 568 T; 0 other;
     gatcactgga agcaggcgtg ggttagtgtc cttatccgag gcagcctgga ggacagctgg        60
     ctaagaggta cggagaagtc aaacttggga taccgggaga gggagagatg aaaacaactt       120
     ctcaatttct ctgcggctga cagaagctcc tgagagaggc tttcagaact tgattccagc       180
     tggcccgtga aagctgtgtc tggacgggag agcctcagag gaataaacag tgccttctct       240
     ggcttctccg ggtcatgacc agtctgttca gaaggaagtg gtgtttctct gaccccactg       300
     ttcccacagc cccctggatg gtagatcatg gggctgcacc cttccccacc cttgggaact       360
     cagtcaaacg gttatcttta tctcgccagc ttgtcctcgt gcttgaccag cgcagtttca       420
     cttttgcaaa catctgttta tatcccttga gagaaaaaat atcaagcaac ctgcctcaaa       480
     cgacgctgtt ttgtccggtg agcaaggaca gcctccgatg gataactaca cagtggcccc       540
     ggacgatgaa tatgatgtcc taatcttaga cgactacctg gacaacagtg ggccggacca       600
     agttccggcc cccgagttcc tctcccccca gcaggtgctg cagttctgct gcgcggtgtt       660
     tgcggtgggt ctcttggaca acgtgctggc ggtgtttatc ttggtgaaat acaaaggact       720
     caagaatctg gggaacatct acttcctaaa cctggcactt tcaaacctgt gtttcctgct       780
     tcccctgccg ttctgggccc atactgcagc acacggggaa agccctggca atgggacctg       840
     taaagttctt gtcggactcc actcctcggg cttatacagc gaggtgtttt ccaacatcct       900
     cctccttgtg caaggataca gggtgttttc ccaagggcga ctggcctcca tcttcacgac       960
     agtgtcttgt ggtattgttg cgtgcatcct ggcatgggcc atggctactg cgctctcttt      1020
     gcccgagtct gtgttttatg agcctcggat ggaaagacag aaacacaagt gtgcctttgg      1080
     caaacctcac ttcttgccaa tcgaagcgcc gctctggaag tacgttctga cgtcaaaaat      1140
     gatcatcttg gtacttgctt ttcctctgct ggtttttata atctgctgca ggcaactgag      1200
     gagaaggcag agcttcaggg agagacagta cgacctccac aagccggctc ttgtcataac      1260
     gggcgtgttc cttttgatgt gggcgcctta caacactgtg cttttcctgt ctgctttcca      1320
     ggaacacttg tccctgcagg atgagaagag cagctaccac ctggacgcaa gtgttcaggt      1380
     cacacagctg gtagcgacca cccactgctg cgtcaacccg ctgctctatt tgcttcttga      1440
     ccggaaggcc tttatgagat accttcgcag cctgttccca cggtgcaatg atatccccta      1500
     tcaaagtagt ggaggctatc agcaagcgcc tccaagggaa ggtcatggca ggcccattga      1560
     actgtacagc aatttgcatc aaaggcagga tataatataa tataaacact caaccttgtc      1620
     tcttcacatt gttttatgcc atttttatat gtttgtataa aaatagaata taagaggaaa      1680
     gggggctggt taatgaacat ttactactaa gcgttgaatt tgtctctggc acacggttaa      1740
     gttatttata aaggtgaatt ccactcttcc tctttagcgt ttgtccgcag tgtgggcgtg      1800
     ggcggtgtgc attccataaa ctgaagctcg gtagttgtcc aaagttacat aactataaag      1860
     tggcaaaact gatgtgtaaa ctcagagatc actggcccca gagtctgtga gttatccaag      1920
     cgtgccagct tttcagtaac tgtcagctag cagtggtggc atgtctgtca tcccagcact      1980
     ctaggaggcg gaggcaggag gcatctcaca aatgcaagta taacctgact tcccccaacc      2040
     tcaattcttt tttttttgtt gttgttgttg ttcatcaaaa tacatgcaat aaatatatat      2100
     atttttaaag c                                                           2111
//


spacer
spacer