spacer

EBI Dbfetch

ID   AK007621; SV 1; linear; mRNA; HTC; MUS; 611 BP.
XX
AC   AK007621;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus 10 day old male pancreas cDNA, RIKEN full-length enriched
DE   library, clone:1810027M14 product:UNCHARACTERIZED HEMATOPOIETIC
DE   STEM/PROGENITOR CELLS PROTEIN MDS033 homolog [Homo sapiens], full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-611
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 42b70e1371dcf1d31198a36f377265e8.
DR   Ensembl-Gn; ENSMUSG00000036835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043898; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1810027M14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..611
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="10 day old"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1810027M14"
FT                   /tissue_type="pancreas"
FT                   /db_xref="taxon:10090"
FT   CDS             179..484
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UNCHARACTERIZED HEMATOPOIETIC STEM/PROGENITOR CELLS
FT                   PROTEIN MDS033 homolog [Homo sapiens] (SPTR|Q9NZ42,
FT                   evidence: FASTY, 96%ID, 100%length, match=303)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9CQR7"
FT                   /db_xref="InterPro:IPR019379"
FT                   /db_xref="MGI:MGI:1913590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQR7"
FT                   /protein_id="BAB25141.1"
FT                   /translation="MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAP
FT                   AYTEQSQIKGYVWRSAVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP"
FT   polyA_signal    593..598
FT                   /note="putative"
FT   polyA_site      611
FT                   /note="putative"
XX
SQ   Sequence 611 BP; 132 A; 182 C; 137 G; 160 T; 0 other;
     ggaaaaaaaa aagcgacaac aaactccact gaaaactgcg gcatctcccc caaatctccc        60
     gcaaaggaat ccaggcagaa gggataaacc gcactggggc gtggttgctc gtgatcttgc       120
     gtctgtcatt tgggtcttgc tctgcagacc cttaggacca ccgggctcca gcgcaactat       180
     gaacttggag cgggtatcca atgaggagaa gttgaacctg tgccggaagt actatcttgg       240
     tggatttgcg ttcctgcctt ttctttggtt agtcaacatt ttctggttct tcagagaggc       300
     gttcctcgcc ccagcctaca cagagcagag ccaaatcaaa ggctatgttt ggcgctcagc       360
     tgtgggcttc ctcttctggg tgatcattct cgccacctgg atcaccatct tccagatcta       420
     ccgcccccgc tggggcgctc ttggggacta cctctccttc accattcccc tgggcactcc       480
     ctaacaactt cataagctgc tgatctgttc tttctcccag gatgaaggct tctctgctct       540
     aggctttccc tcagaccctg aagacatctg tttctcattt cccatctgcc ccaataaagg       600
     accctaactt t                                                            611
//


spacer
spacer