Dbfetch

ID   AK007240; SV 1; linear; mRNA; HTC; MUS; 1324 BP.
XX
AC   AK007240;
XX
DT   08-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 20)
XX
DE   Mus musculus adult male testis cDNA, RIKEN full-length enriched library,
DE   clone:1700122I06 product:N-acetylglucosamine kinase, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1324
RA   Adachi J., Aizawa K., Akahira S., Akimura T., Arai A., Aono H., Arakawa T.,
RA   Bono H., Carninci P., Fukuda S., Fukunishi Y., Furuno M., Hanagaki T.,
RA   Hara A., Hayatsu N., Hiramoto K., Hiraoka T., Hori F., Imotani K.,
RA   Ishii Y., Itoh M., Izawa M., Kasukawa T., Kato H., Kawai J., Kojima Y.,
RA   Konno H., Kouda M., Koya S., Kurihara C., Matsuyama T., Miyazaki A.,
RA   Nishi K., Nomura K., Numazaki R., Ohno M., Okazaki Y., Okido T., Owa C.,
RA   Saito H., Saito R., Sakai C., Sakai K., Sano H., Sasaki D., Shibata K.,
RA   Shibata Y., Shinagawa A., Shiraki T., Sogabe Y., Suzuki H., Tagami M.,
RA   Tagawa A., Takahashi F., Tanaka T., Tejima Y., Toya T., Yamamura T.,
RA   Yasunishi A., Yoshida K., Yoshino M., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (10-JUL-2000) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 34e0619161e2ab579b199cbccaedcffb.
DR   Ensembl-Gn; ENSMUSG00000034744; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030941; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031380; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030713; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029744; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030110; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000113851; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0078375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0078451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0078368; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0078394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0078860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0078590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0077971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0078133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0078021; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0078161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0078021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0079103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0078015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0077124; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=1700122I06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1324
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="1700122I06"
FT                   /tissue_type="testis"
FT                   /db_xref="taxon:10090"
FT   CDS             139..1224
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-acetylglucosamine kinase (MGD|MGI:1860418
FT                   GB|NM_019542, evidence: BLASTN, 100%, match=1104)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D997"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="MGI:MGI:1860418"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D997"
FT                   /protein_id="BAB24909.1"
FT                   /translation="MTRGGARVGGSEVTARVEVATADQRWQRGGTRSKVLLLSEDGQIL
FT                   AEADGLSTNHWLIGTDQCVERINEMVDRAKQKAGVDPLVPLRSLGLSLSGGEQEDAVRL
FT                   LIEELRHRFPNLSENYLITTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSESGCGG
FT                   WGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGHVKQAMFDYFQVPDRLGILTHL
FT                   YRDFDKCKFAGFCQKIAEGAHQGDPLSRYIFRKAGEMLGRHVVAVLPEIDPVLFQGELG
FT                   LPILCVGSVWKSWELLKEGFLLALTLGREQQAQNSFSSFTLMKLRHSSALGGASLGARH
FT                   IGYHLPMDYSINAIAFYSYTF"
FT   regulatory      1300..1305
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1324
FT                   /note="putative"
XX
SQ   Sequence 1324 BP; 306 A; 333 C; 402 G; 283 T; 0 other;
     gagctggggt gccgcctcct cgcgaaagct cacttgaacg gcgggctaga aaaaaccgga        60
     ggggaaagct gcgggaggcg acagcagggg cgagagagga cgtagcatcc acaccctacg       120
     caagcgcgtc gtagtcacat gacaaggggc ggtgcccgtg tgggcgggag cgaagtcacg       180
     gctagggtcg aggttgctac ggcggaccag cggtggcaac ggggaggcac acggtccaaa       240
     gtccttttac tttctgagga tgggcagatc ctggcagaag cagatggact gagcacaaac       300
     cactggctga ttggcacaga ccagtgtgtg gagaggatca atgagatggt ggacagggcc       360
     aaacagaagg ctggagtgga tcctctggtg ccccttcgaa gcctgggcct gtccctgagt       420
     ggtggggagc aggaggatgc agtgaggctc ctgattgagg agttgaggca ccgctttccc       480
     aacctgagtg aaaactactt aatcaccacg gatgcagcag gttccatcgc cacagccaca       540
     ccggacggtg ggattgtgct catctctgga acaggctcca actgtaggct tatcaaccct       600
     gatggctccg agagtggctg tggaggctgg ggccacatga tgggagacga gggctcagcc       660
     tactggattg cacaccaagc tgtgaaaatt gtgtttgatt ccatcgacaa cctggaggca       720
     gctcctcatg atattggcca tgtcaagcag gccatgttcg actatttcca ggtgccagat       780
     cggcttggaa tcctcaccca tttgtatagg gactttgata aatgcaagtt tgctggattt       840
     tgccagaaaa ttgcagaagg tgcacatcag ggagaccctc tttccaggta catcttcagg       900
     aaggctggag agatgctggg cagacatgtt gtggcagtat tgccagagat tgacccggtt       960
     ttgttccaag gggagcttgg cctccccatt ctgtgtgtgg gctcagtgtg gaagagctgg      1020
     gagctcctga aggaaggctt tctcctggcg ctgacgctgg gccgagagca gcaggcacag      1080
     aactccttct ccagcttcac cctgatgaag ttgcggcatt cttctgcatt ggggggtgcc      1140
     agcctggggg ccaggcacat tggataccac cttcccatgg actacagtat caatgccatt      1200
     gccttctatt cctatacctt ctagagtctg tccccctgcc caaccagcca acaccgagag      1260
     ctgggagact ttccttttta aaaaacacat atggaagaaa ataaatgcac tttactcctt      1320
     ccct                                                                   1324
//